Viewing data for Ambystoma mexicanum


Scientific name Ambystoma mexicanum
Common name Axolotl
Maximum lifespan 17.00 years (Ambystoma mexicanum@AnAge)

Total mtDNA (size: 16369 bases) GC AT G C A T
Base content (bases) 5444 10925 3281 2163 5225 5700
Base content per 1 kb (bases) 333 667 200 132 319 348
Base content (%) 33.3% 66.7%
Total protein-coding genes (size: 11324 bases) GC AT G C A T
Base content (bases) 3697 7627 2317 1380 3789 3838
Base content per 1 kb (bases) 326 674 205 122 335 339
Base content (%) 32.6% 67.4%
D-loop (size: 738 bases) GC AT G C A T
Base content (bases) 274 464 157 117 238 226
Base content per 1 kb (bases) 371 629 213 159 322 306
Base content (%) 37.1% 62.9%
Total tRNA-coding genes (size: 1526 bases) GC AT G C A T
Base content (bases) 497 1029 286 211 461 568
Base content per 1 kb (bases) 326 674 187 138 302 372
Base content (%) 32.6% 67.4%
Total rRNA-coding genes (size: 2483 bases) GC AT G C A T
Base content (bases) 864 1619 450 414 642 977
Base content per 1 kb (bases) 348 652 181 167 259 393
Base content (%) 34.8% 65.2%
12S rRNA gene (size: 928 bases) GC AT G C A T
Base content (bases) 350 578 188 162 225 353
Base content per 1 kb (bases) 377 623 203 175 242 380
Base content (%) 37.7% 62.3%
16S rRNA gene (size: 1555 bases) GC AT G C A T
Base content (bases) 514 1041 262 252 417 624
Base content per 1 kb (bases) 331 669 168 162 268 401
Base content (%) 33.1% 66.9%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 224 460 149 75 248 212
Base content per 1 kb (bases) 327 673 218 110 363 310
Base content (%) 32.7% 67.3%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 43 125 32 11 53 72
Base content per 1 kb (bases) 256 744 190 65 315 429
Base content (%) 25.6% 74.4%
COX1 (size: 1548 bases) GC AT G C A T
Base content (bases) 565 983 304 261 530 453
Base content per 1 kb (bases) 365 635 196 169 342 293
Base content (%) 36.5% 63.5%
COX2 (size: 686 bases) GC AT G C A T
Base content (bases) 242 444 140 102 207 237
Base content per 1 kb (bases) 353 647 204 149 302 345
Base content (%) 35.3% 64.7%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 285 499 162 123 262 237
Base content per 1 kb (bases) 364 636 207 157 334 302
Base content (%) 36.4% 63.6%
CYTB (size: 1141 bases) GC AT G C A T
Base content (bases) 368 773 232 136 401 372
Base content per 1 kb (bases) 323 677 203 119 351 326
Base content (%) 32.3% 67.7%
ND1 (size: 969 bases) GC AT G C A T
Base content (bases) 298 671 195 103 338 333
Base content per 1 kb (bases) 308 692 201 106 349 344
Base content (%) 30.8% 69.2%
ND2 (size: 1044 bases) GC AT G C A T
Base content (bases) 296 748 201 95 344 404
Base content per 1 kb (bases) 284 716 193 91 330 387
Base content (%) 28.4% 71.6%
ND3 (size: 348 bases) GC AT G C A T
Base content (bases) 117 231 69 48 130 101
Base content per 1 kb (bases) 336 664 198 138 374 290
Base content (%) 33.6% 66.4%
ND4 (size: 1375 bases) GC AT G C A T
Base content (bases) 448 927 295 153 457 470
Base content per 1 kb (bases) 326 674 215 111 332 342
Base content (%) 32.6% 67.4%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 93 204 62 31 108 96
Base content per 1 kb (bases) 313 687 209 104 364 323
Base content (%) 31.3% 68.7%
ND5 (size: 1797 bases) GC AT G C A T
Base content (bases) 564 1233 368 196 618 615
Base content per 1 kb (bases) 314 686 205 109 344 342
Base content (%) 31.4% 68.6%
ND6 (size: 516 bases) GC AT G C A T
Base content (bases) 165 351 115 50 102 249
Base content per 1 kb (bases) 320 680 223 97 198 483
Base content (%) 32.0% 68.0%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.96%)
Alanine (Ala, A)
n = 18 (7.93%)
Serine (Ser, S)
n = 10 (4.41%)
Threonine (Thr, T)
n = 25 (11.01%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (3.96%)
Leucine (Leu, L)
n = 54 (23.79%)
Isoleucine (Ile, I)
n = 21 (9.25%)
Methionine (Met, M)
n = 11 (4.85%)
Proline (Pro, P)
n = 16 (7.05%)
Phenylalanine (Phe, F)
n = 12 (5.29%)
Tyrosine (Tyr, Y)
n = 5 (2.2%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 2 (0.88%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 8 (3.52%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 2 (0.88%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 3 8 14 1 9 1 28 8 0 3 1 5 0 10 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 11 1 5 1 2 1 4 2 5 0 11 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 12 0 1 2 2 0 1 4 5 0 0 1 2 6 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 4 0 1 1 2 1 1 2 2 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
42 56 73 57
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
24 64 33 107
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 29 106 84
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPGPWFAILIMSWFIYLFILMSKTNNFKYNNEPNMQNVKKMKPQSWNWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 1 (1.82%)
Alanine (Ala, A)
n = 1 (1.82%)
Serine (Ser, S)
n = 3 (5.45%)
Threonine (Thr, T)
n = 2 (3.64%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.82%)
Leucine (Leu, L)
n = 4 (7.27%)
Isoleucine (Ile, I)
n = 4 (7.27%)
Methionine (Met, M)
n = 5 (9.09%)
Proline (Pro, P)
n = 6 (10.91%)
Phenylalanine (Phe, F)
n = 4 (7.27%)
Tyrosine (Tyr, Y)
n = 2 (3.64%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 1 (1.82%)
Asparagine (Asn, N)
n = 8 (14.55%)
Glutamine (Gln, Q)
n = 3 (5.45%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 5 (9.09%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 2 4 0 0 2 0 2 3 0 0 0 1 0 4 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 1 0 0 1 0 0 1 2 3 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 0 0 3 0 0 0 0 0 2 0 0 0 5 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 0 0 0 5 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
4 11 24 17
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 12 20 18
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
1 9 28 18
COX1 (size: 1548 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 45 (8.74%)
Alanine (Ala, A)
n = 43 (8.35%)
Serine (Ser, S)
n = 37 (7.18%)
Threonine (Thr, T)
n = 35 (6.8%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 41 (7.96%)
Leucine (Leu, L)
n = 61 (11.84%)
Isoleucine (Ile, I)
n = 38 (7.38%)
Methionine (Met, M)
n = 29 (5.63%)
Proline (Pro, P)
n = 26 (5.05%)
Phenylalanine (Phe, F)
n = 40 (7.77%)
Tyrosine (Tyr, Y)
n = 18 (3.5%)
Tryptophan (Trp, W)
n = 17 (3.3%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 16 (3.11%)
Glutamine (Gln, Q)
n = 7 (1.36%)
Histidine (His, H)
n = 19 (3.69%)
Lysine (Lys, K)
n = 8 (1.55%)
Arginine (Arg, R)
n = 9 (1.75%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
25 13 27 15 1 14 4 27 7 0 13 2 22 4 32 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 9 10 23 1 11 4 19 11 9 5 11 1 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 19 3 10 2 19 2 0 4 15 3 2 0 9 7 12
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 9 1 14 1 8 0 1 0 8 0 0 0 1 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
154 95 130 137
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 137 94 209
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
31 72 229 184
COX2 (size: 686 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.96%)
Alanine (Ala, A)
n = 15 (6.61%)
Serine (Ser, S)
n = 16 (7.05%)
Threonine (Thr, T)
n = 15 (6.61%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 15 (6.61%)
Leucine (Leu, L)
n = 23 (10.13%)
Isoleucine (Ile, I)
n = 18 (7.93%)
Methionine (Met, M)
n = 17 (7.49%)
Proline (Pro, P)
n = 14 (6.17%)
Phenylalanine (Phe, F)
n = 9 (3.96%)
Tyrosine (Tyr, Y)
n = 8 (3.52%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 11 (4.85%)
Glutamic acid (Glu, E)
n = 14 (6.17%)
Asparagine (Asn, N)
n = 10 (4.41%)
Glutamine (Gln, Q)
n = 9 (3.96%)
Histidine (His, H)
n = 9 (3.96%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 0 14 5 0 4 1 13 9 0 5 2 6 2 6 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 1 3 5 6 1 4 0 4 1 3 0 10 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 7 0 1 3 9 0 1 2 4 4 0 0 5 5 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 11 3 7 4 3 0 0 0 5 1 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
64 48 66 50
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 57 64 82
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 35 106 74
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 21 (8.08%)
Serine (Ser, S)
n = 15 (5.77%)
Threonine (Thr, T)
n = 19 (7.31%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 18 (6.92%)
Leucine (Leu, L)
n = 34 (13.08%)
Isoleucine (Ile, I)
n = 14 (5.38%)
Methionine (Met, M)
n = 11 (4.23%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 23 (8.85%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 6 (2.31%)
Glutamic acid (Glu, E)
n = 9 (3.46%)
Asparagine (Asn, N)
n = 5 (1.92%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 14 (5.38%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 5 10 5 0 8 0 21 8 0 10 3 5 0 15 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 1 7 3 11 0 3 3 10 4 2 0 10 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 12 1 5 0 7 0 0 3 6 5 0 0 3 2 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 8 1 3 3 2 0 1 0 4 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 52 54 81
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 64 55 100
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 46 128 80
CYTB (size: 1141 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (6.86%)
Alanine (Ala, A)
n = 20 (5.28%)
Serine (Ser, S)
n = 28 (7.39%)
Threonine (Thr, T)
n = 22 (5.8%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 12 (3.17%)
Leucine (Leu, L)
n = 48 (12.66%)
Isoleucine (Ile, I)
n = 44 (11.61%)
Methionine (Met, M)
n = 24 (6.33%)
Proline (Pro, P)
n = 22 (5.8%)
Phenylalanine (Phe, F)
n = 34 (8.97%)
Tyrosine (Tyr, Y)
n = 13 (3.43%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 8 (2.11%)
Glutamic acid (Glu, E)
n = 7 (1.85%)
Asparagine (Asn, N)
n = 18 (4.75%)
Glutamine (Gln, Q)
n = 9 (2.37%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 10 (2.64%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
34 10 20 11 1 18 0 17 9 0 6 0 6 0 21 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 2 8 3 9 0 3 2 18 3 3 1 17 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 12 1 8 2 16 0 1 1 12 1 1 1 10 8 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 7 0 6 2 9 1 0 2 6 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
73 81 120 106
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
51 90 77 162
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 61 175 132
ND1 (size: 969 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.97%)
Alanine (Ala, A)
n = 22 (6.83%)
Serine (Ser, S)
n = 22 (6.83%)
Threonine (Thr, T)
n = 24 (7.45%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 12 (3.73%)
Leucine (Leu, L)
n = 60 (18.63%)
Isoleucine (Ile, I)
n = 27 (8.39%)
Methionine (Met, M)
n = 20 (6.21%)
Proline (Pro, P)
n = 21 (6.52%)
Phenylalanine (Phe, F)
n = 22 (6.83%)
Tyrosine (Tyr, Y)
n = 11 (3.42%)
Tryptophan (Trp, W)
n = 7 (2.17%)
Aspartic acid (Asp, D)
n = 3 (0.93%)
Glutamic acid (Glu, E)
n = 11 (3.42%)
Asparagine (Asn, N)
n = 18 (5.59%)
Glutamine (Gln, Q)
n = 8 (2.48%)
Histidine (His, H)
n = 2 (0.62%)
Lysine (Lys, K)
n = 7 (2.17%)
Arginine (Arg, R)
n = 8 (2.48%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 4 19 9 2 18 1 30 8 0 4 0 8 0 18 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 0 5 5 11 1 6 3 6 1 4 2 14 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 14 0 3 2 16 0 0 1 10 1 1 0 10 8 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 11 0 3 0 7 0 1 1 6 0 0 0 1 0 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
64 69 97 93
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 88 61 141
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 38 175 104
ND2 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.03%)
Alanine (Ala, A)
n = 24 (6.92%)
Serine (Ser, S)
n = 30 (8.65%)
Threonine (Thr, T)
n = 38 (10.95%)
Cysteine (Cys, C)
n = 2 (0.58%)
Valine (Val, V)
n = 7 (2.02%)
Leucine (Leu, L)
n = 53 (15.27%)
Isoleucine (Ile, I)
n = 36 (10.37%)
Methionine (Met, M)
n = 38 (10.95%)
Proline (Pro, P)
n = 16 (4.61%)
Phenylalanine (Phe, F)
n = 14 (4.03%)
Tyrosine (Tyr, Y)
n = 7 (2.02%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.44%)
Asparagine (Asn, N)
n = 20 (5.76%)
Glutamine (Gln, Q)
n = 11 (3.17%)
Histidine (His, H)
n = 6 (1.73%)
Lysine (Lys, K)
n = 10 (2.88%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
31 5 35 6 2 14 0 31 11 0 1 1 5 0 11 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 0 11 0 13 0 2 1 10 1 3 1 10 2 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 19 1 3 3 20 0 0 4 7 0 1 0 14 6 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 5 0 1 0 9 1 0 0 4 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
51 59 146 92
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
35 104 61 148
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 38 197 104
ND3 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.03%)
Alanine (Ala, A)
n = 24 (6.92%)
Serine (Ser, S)
n = 30 (8.65%)
Threonine (Thr, T)
n = 38 (10.95%)
Cysteine (Cys, C)
n = 2 (0.58%)
Valine (Val, V)
n = 7 (2.02%)
Leucine (Leu, L)
n = 53 (15.27%)
Isoleucine (Ile, I)
n = 36 (10.37%)
Methionine (Met, M)
n = 38 (10.95%)
Proline (Pro, P)
n = 16 (4.61%)
Phenylalanine (Phe, F)
n = 14 (4.03%)
Tyrosine (Tyr, Y)
n = 7 (2.02%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.44%)
Asparagine (Asn, N)
n = 20 (5.76%)
Glutamine (Gln, Q)
n = 11 (3.17%)
Histidine (His, H)
n = 6 (1.73%)
Lysine (Lys, K)
n = 10 (2.88%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
31 5 35 6 2 14 0 31 11 0 1 1 5 0 11 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 0 11 0 13 0 2 1 10 1 3 1 10 2 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 19 1 3 3 20 0 0 4 7 0 1 0 14 6 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 5 0 1 0 9 1 0 0 4 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
51 59 146 92
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
35 104 61 148
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 38 197 104
ND4 (size: 1375 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (4.6%)
Alanine (Ala, A)
n = 25 (5.47%)
Serine (Ser, S)
n = 34 (7.44%)
Threonine (Thr, T)
n = 37 (8.1%)
Cysteine (Cys, C)
n = 6 (1.31%)
Valine (Val, V)
n = 14 (3.06%)
Leucine (Leu, L)
n = 88 (19.26%)
Isoleucine (Ile, I)
n = 42 (9.19%)
Methionine (Met, M)
n = 37 (8.1%)
Proline (Pro, P)
n = 22 (4.81%)
Phenylalanine (Phe, F)
n = 19 (4.16%)
Tyrosine (Tyr, Y)
n = 17 (3.72%)
Tryptophan (Trp, W)
n = 14 (3.06%)
Aspartic acid (Asp, D)
n = 2 (0.44%)
Glutamic acid (Glu, E)
n = 12 (2.63%)
Asparagine (Asn, N)
n = 18 (3.94%)
Glutamine (Gln, Q)
n = 13 (2.84%)
Histidine (His, H)
n = 10 (2.19%)
Lysine (Lys, K)
n = 16 (3.5%)
Arginine (Arg, R)
n = 11 (2.41%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
32 10 32 26 4 21 4 32 13 0 6 2 6 0 16 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 2 4 4 9 11 1 1 4 12 4 4 4 14 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 21 1 7 2 18 0 2 5 12 5 1 1 8 10 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 10 2 1 1 15 1 3 1 7 0 0 0 0 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 111 157 116
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
59 111 88 200
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 73 225 140
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 8 (8.16%)
Serine (Ser, S)
n = 11 (11.22%)
Threonine (Thr, T)
n = 9 (9.18%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 1 (1.02%)
Leucine (Leu, L)
n = 18 (18.37%)
Isoleucine (Ile, I)
n = 9 (9.18%)
Methionine (Met, M)
n = 9 (9.18%)
Proline (Pro, P)
n = 3 (3.06%)
Phenylalanine (Phe, F)
n = 7 (7.14%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 3 (3.06%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 4 (4.08%)
Lysine (Lys, K)
n = 1 (1.02%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 2 7 8 0 1 0 9 2 0 0 0 1 0 7 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 3 0 4 1 0 1 3 0 0 0 3 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 7 0 4 0 5 0 0 2 0 0 0 0 2 1 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 2 0 0 1 1 0 0 0 2 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
16 20 33 30
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
12 29 14 44
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 13 49 34
ND5 (size: 1797 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (4.68%)
Alanine (Ala, A)
n = 39 (6.52%)
Serine (Ser, S)
n = 54 (9.03%)
Threonine (Thr, T)
n = 45 (7.53%)
Cysteine (Cys, C)
n = 6 (1.0%)
Valine (Val, V)
n = 19 (3.18%)
Leucine (Leu, L)
n = 88 (14.72%)
Isoleucine (Ile, I)
n = 62 (10.37%)
Methionine (Met, M)
n = 36 (6.02%)
Proline (Pro, P)
n = 25 (4.18%)
Phenylalanine (Phe, F)
n = 41 (6.86%)
Tyrosine (Tyr, Y)
n = 17 (2.84%)
Tryptophan (Trp, W)
n = 13 (2.17%)
Aspartic acid (Asp, D)
n = 13 (2.17%)
Glutamic acid (Glu, E)
n = 13 (2.17%)
Asparagine (Asn, N)
n = 35 (5.85%)
Glutamine (Gln, Q)
n = 21 (3.51%)
Histidine (His, H)
n = 10 (1.67%)
Lysine (Lys, K)
n = 24 (4.01%)
Arginine (Arg, R)
n = 9 (1.51%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
43 19 33 14 4 27 1 39 19 2 6 0 11 2 30 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 4 2 12 10 17 0 10 2 14 2 5 6 13 1 14
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 23 2 14 10 21 1 5 3 13 4 2 3 20 15 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 12 1 8 5 24 0 3 0 6 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
112 111 210 166
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
64 155 134 246
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 102 271 206
ND6 (size: 516 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (11.11%)
Alanine (Ala, A)
n = 13 (7.6%)
Serine (Ser, S)
n = 15 (8.77%)
Threonine (Thr, T)
n = 3 (1.75%)
Cysteine (Cys, C)
n = 4 (2.34%)
Valine (Val, V)
n = 19 (11.11%)
Leucine (Leu, L)
n = 27 (15.79%)
Isoleucine (Ile, I)
n = 10 (5.85%)
Methionine (Met, M)
n = 10 (5.85%)
Proline (Pro, P)
n = 4 (2.34%)
Phenylalanine (Phe, F)
n = 17 (9.94%)
Tyrosine (Tyr, Y)
n = 11 (6.43%)
Tryptophan (Trp, W)
n = 3 (1.75%)
Aspartic acid (Asp, D)
n = 5 (2.92%)
Glutamic acid (Glu, E)
n = 4 (2.34%)
Asparagine (Asn, N)
n = 3 (1.75%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 1 (0.58%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 3 (1.75%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 0 6 3 0 0 0 22 0 0 11 0 8 0 14 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 4 0 5 0 7 1 9 1 0 9 2 1 0 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 1 0 11 0 2 0 2 0 11 0 1 2 3 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 4 5 0 0 0 2 0 0 1 1 0 0 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
60 11 29 72
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 33 24 83
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
23 6 49 94
Total protein-coding genes (size: 11357 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 218 (5.76%)
Alanine (Ala, A)
n = 255 (6.74%)
Serine (Ser, S)
n = 282 (7.45%)
Threonine (Thr, T)
n = 282 (7.45%)
Cysteine (Cys, C)
n = 31 (0.82%)
Valine (Val, V)
n = 170 (4.49%)
Leucine (Leu, L)
n = 584 (15.44%)
Isoleucine (Ile, I)
n = 336 (8.88%)
Methionine (Met, M)
n = 253 (6.69%)
Proline (Pro, P)
n = 195 (5.15%)
Phenylalanine (Phe, F)
n = 251 (6.63%)
Tyrosine (Tyr, Y)
n = 122 (3.22%)
Tryptophan (Trp, W)
n = 110 (2.91%)
Aspartic acid (Asp, D)
n = 71 (1.88%)
Glutamic acid (Glu, E)
n = 97 (2.56%)
Asparagine (Asn, N)
n = 166 (4.39%)
Glutamine (Gln, Q)
n = 101 (2.67%)
Histidine (His, H)
n = 89 (2.35%)
Lysine (Lys, K)
n = 90 (2.38%)
Arginine (Arg, R)
n = 72 (1.9%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
261 75 220 121 15 142 14 283 99 2 65 11 86 8 193 58
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
33 17 14 81 48 119 7 53 24 102 39 41 22 122 10 74
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
47 151 10 73 28 137 3 12 29 98 24 11 9 92 74 48
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
41 85 12 51 20 86 4 12 7 51 2 1 0 7 1 99
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
811 749 1169 1055
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
473 973 744 1594
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
165 537 1790 1292

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.