Viewing data for Pinicola enucleator


Scientific name Pinicola enucleator
Common name Pine grosbeak
Maximum lifespan 9.80 years (Pinicola enucleator@AnAge)

Total mtDNA (size: 16818 bases) GC AT G C A T
Base content (bases) 7512 9301 5135 2377 4071 5230
Base content per 1 kb (bases) 447 553 305 141 242 311
Base content (%) 44.7% 55.3%
Total protein-coding genes (size: 11378 bases) GC AT G C A T
Base content (bases) 5161 6212 3729 1432 2747 3465
Base content per 1 kb (bases) 454 546 328 126 241 305
Base content (%) 45.4% 54.6%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1541 bases) GC AT G C A T
Base content (bases) 635 906 374 261 392 514
Base content per 1 kb (bases) 412 588 243 169 254 334
Base content (%) 41.2% 58.8%
Total rRNA-coding genes (size: 2575 bases) GC AT G C A T
Base content (bases) 1174 1401 651 523 548 853
Base content per 1 kb (bases) 456 544 253 203 213 331
Base content (%) 45.6% 54.4%
12S rRNA gene (size: 976 bases) GC AT G C A T
Base content (bases) 471 505 264 207 206 299
Base content per 1 kb (bases) 483 517 270 212 211 306
Base content (%) 48.3% 51.7%
16S rRNA gene (size: 1599 bases) GC AT G C A T
Base content (bases) 703 896 387 316 342 554
Base content per 1 kb (bases) 440 560 242 198 214 346
Base content (%) 44.0% 56.0%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 296 388 229 67 169 219
Base content per 1 kb (bases) 433 567 335 98 247 320
Base content (%) 43.3% 56.7%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 69 99 57 12 47 52
Base content per 1 kb (bases) 411 589 339 71 280 310
Base content (%) 41.1% 58.9%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 716 835 462 254 395 440
Base content per 1 kb (bases) 462 538 298 164 255 284
Base content (%) 46.2% 53.8%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 315 369 213 102 158 211
Base content per 1 kb (bases) 461 539 311 149 231 308
Base content (%) 46.1% 53.9%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 368 415 250 118 194 221
Base content per 1 kb (bases) 469 529 319 151 247 282
Base content (%) 46.9% 52.9%
CYTB (size: 1143 bases) GC AT G C A T
Base content (bases) 524 619 374 150 280 339
Base content per 1 kb (bases) 458 542 327 131 245 297
Base content (%) 45.8% 54.2%
ND1 (size: 978 bases) GC AT G C A T
Base content (bases) 434 544 297 137 271 273
Base content per 1 kb (bases) 444 556 304 140 277 279
Base content (%) 44.4% 55.6%
ND2 (size: 1040 bases) GC AT G C A T
Base content (bases) 469 571 363 106 253 318
Base content per 1 kb (bases) 451 549 349 102 243 306
Base content (%) 45.1% 54.9%
ND3 (size: 351 bases) GC AT G C A T
Base content (bases) 159 192 114 45 87 105
Base content per 1 kb (bases) 453 547 325 128 248 299
Base content (%) 45.3% 54.7%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 627 751 476 151 328 423
Base content per 1 kb (bases) 455 545 345 110 238 307
Base content (%) 45.5% 54.5%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 150 147 114 36 65 82
Base content per 1 kb (bases) 505 495 384 121 219 276
Base content (%) 50.5% 49.5%
ND5 (size: 1818 bases) GC AT G C A T
Base content (bases) 789 1027 585 204 441 586
Base content per 1 kb (bases) 434 565 322 112 243 322
Base content (%) 43.4% 56.5%
ND6 (size: 519 bases) GC AT G C A T
Base content (bases) 250 267 198 52 63 204
Base content per 1 kb (bases) 482 514 382 100 121 393
Base content (%) 48.2% 51.4%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 7 (3.08%)
Alanine (Ala, A)
n = 17 (7.49%)
Serine (Ser, S)
n = 16 (7.05%)
Threonine (Thr, T)
n = 22 (9.69%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (3.96%)
Leucine (Leu, L)
n = 61 (26.87%)
Isoleucine (Ile, I)
n = 18 (7.93%)
Methionine (Met, M)
n = 8 (3.52%)
Proline (Pro, P)
n = 15 (6.61%)
Phenylalanine (Phe, F)
n = 11 (4.85%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 3 (1.32%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 9 (3.96%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 15 7 5 8 35 6 7 8 0 2 1 6 0 1 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 2 10 5 0 3 0 4 0 1 3 11 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 14 0 0 6 6 0 0 4 1 2 0 0 1 8 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 4 0 1 2 4 0 1 1 3 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
40 85 65 38
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
20 66 35 107
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 78 119 24
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPAPWFFIMIISWLTFSLIIQPKILSFVSMNPPSNKPPVAPSTTPWTWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 2 (3.64%)
Serine (Ser, S)
n = 6 (10.91%)
Threonine (Thr, T)
n = 5 (9.09%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 2 (3.64%)
Leucine (Leu, L)
n = 4 (7.27%)
Isoleucine (Ile, I)
n = 6 (10.91%)
Methionine (Met, M)
n = 3 (5.45%)
Proline (Pro, P)
n = 11 (20.0%)
Phenylalanine (Phe, F)
n = 4 (7.27%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 3 (5.45%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 2 (3.64%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 4 1 0 2 2 0 0 2 0 1 0 1 0 3 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 1 0 1 0 0 0 0 0 4 1 6 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 0 0 0 2 3 0 0 1 0 0 0 0 0 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 0 0 2 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
4 17 20 15
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 23 8 19
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 17 24 13
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.11%)
Alanine (Ala, A)
n = 45 (8.72%)
Serine (Ser, S)
n = 29 (5.62%)
Threonine (Thr, T)
n = 37 (7.17%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 41 (7.95%)
Leucine (Leu, L)
n = 63 (12.21%)
Isoleucine (Ile, I)
n = 39 (7.56%)
Methionine (Met, M)
n = 22 (4.26%)
Proline (Pro, P)
n = 30 (5.81%)
Phenylalanine (Phe, F)
n = 43 (8.33%)
Tyrosine (Tyr, Y)
n = 18 (3.49%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 15 (2.91%)
Glutamine (Gln, Q)
n = 9 (1.74%)
Histidine (His, H)
n = 18 (3.49%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 31 20 7 11 33 3 9 8 1 5 13 20 3 4 39
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 9 19 16 1 7 7 31 2 6 7 16 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 19 0 8 7 9 1 0 4 3 15 2 0 4 11 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 9 1 6 9 9 0 1 2 5 0 0 1 0 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
158 119 127 113
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
78 137 94 208
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 206 219 74
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 16 (7.05%)
Serine (Ser, S)
n = 20 (8.81%)
Threonine (Thr, T)
n = 16 (7.05%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 18 (7.93%)
Leucine (Leu, L)
n = 31 (13.66%)
Isoleucine (Ile, I)
n = 13 (5.73%)
Methionine (Met, M)
n = 12 (5.29%)
Proline (Pro, P)
n = 12 (5.29%)
Phenylalanine (Phe, F)
n = 8 (3.52%)
Tyrosine (Tyr, Y)
n = 7 (3.08%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 12 (5.29%)
Glutamic acid (Glu, E)
n = 13 (5.73%)
Asparagine (Asn, N)
n = 7 (3.08%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 10 (4.41%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 9 9 6 8 12 3 2 6 0 2 3 12 1 1 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 3 2 8 6 0 1 2 5 0 2 3 6 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 7 0 2 11 3 0 0 4 1 6 1 0 2 5 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 13 0 3 9 4 0 0 1 5 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 63 56 42
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 60 60 82
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 90 95 34
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.31%)
Alanine (Ala, A)
n = 23 (8.85%)
Serine (Ser, S)
n = 18 (6.92%)
Threonine (Thr, T)
n = 20 (7.69%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 16 (6.15%)
Leucine (Leu, L)
n = 33 (12.69%)
Isoleucine (Ile, I)
n = 15 (5.77%)
Methionine (Met, M)
n = 7 (2.69%)
Proline (Pro, P)
n = 13 (5.0%)
Phenylalanine (Phe, F)
n = 23 (8.85%)
Tyrosine (Tyr, Y)
n = 10 (3.85%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 5 (1.92%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 4 (1.54%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 12 6 3 5 22 0 3 6 2 2 4 10 0 4 19
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 4 12 7 0 1 2 15 1 2 4 6 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 6 1 5 4 5 0 0 4 1 9 0 0 1 4 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 7 1 0 4 3 1 1 2 2 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 72 55 63
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
41 69 56 94
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 107 110 36
CYTB (size: 1143 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.32%)
Alanine (Ala, A)
n = 29 (7.63%)
Serine (Ser, S)
n = 23 (6.05%)
Threonine (Thr, T)
n = 24 (6.32%)
Cysteine (Cys, C)
n = 4 (1.05%)
Valine (Val, V)
n = 22 (5.79%)
Leucine (Leu, L)
n = 62 (16.32%)
Isoleucine (Ile, I)
n = 34 (8.95%)
Methionine (Met, M)
n = 10 (2.63%)
Proline (Pro, P)
n = 24 (6.32%)
Phenylalanine (Phe, F)
n = 27 (7.11%)
Tyrosine (Tyr, Y)
n = 12 (3.16%)
Tryptophan (Trp, W)
n = 11 (2.89%)
Aspartic acid (Asp, D)
n = 9 (2.37%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 21 (5.53%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 12 (3.16%)
Lysine (Lys, K)
n = 10 (2.63%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 26 9 4 15 39 3 1 8 0 3 6 11 2 2 25
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 4 7 13 7 2 2 5 14 3 3 5 16 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 13 0 2 9 11 0 0 1 0 12 0 0 7 14 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 6 0 0 9 9 1 3 1 4 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
90 113 100 78
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
48 99 79 155
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 162 160 47
ND1 (size: 978 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (4.0%)
Alanine (Ala, A)
n = 30 (9.23%)
Serine (Ser, S)
n = 25 (7.69%)
Threonine (Thr, T)
n = 19 (5.85%)
Cysteine (Cys, C)
n = 3 (0.92%)
Valine (Val, V)
n = 16 (4.92%)
Leucine (Leu, L)
n = 66 (20.31%)
Isoleucine (Ile, I)
n = 23 (7.08%)
Methionine (Met, M)
n = 13 (4.0%)
Proline (Pro, P)
n = 24 (7.38%)
Phenylalanine (Phe, F)
n = 17 (5.23%)
Tyrosine (Tyr, Y)
n = 14 (4.31%)
Tryptophan (Trp, W)
n = 8 (2.46%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.38%)
Asparagine (Asn, N)
n = 15 (4.62%)
Glutamine (Gln, Q)
n = 6 (1.85%)
Histidine (His, H)
n = 3 (0.92%)
Lysine (Lys, K)
n = 7 (2.15%)
Arginine (Arg, R)
n = 8 (2.46%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 14 10 10 10 30 4 9 6 0 2 1 11 2 5 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 2 3 15 9 3 4 4 4 1 5 8 11 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 7 1 5 6 9 0 1 4 5 9 2 3 2 13 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 8 3 1 3 6 1 2 1 3 2 1 0 0 0 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 95 83 74
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 93 60 135
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
25 109 130 62
ND2 (size: 1040 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.48%)
Alanine (Ala, A)
n = 27 (7.83%)
Serine (Ser, S)
n = 33 (9.57%)
Threonine (Thr, T)
n = 40 (11.59%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 8 (2.32%)
Leucine (Leu, L)
n = 67 (19.42%)
Isoleucine (Ile, I)
n = 34 (9.86%)
Methionine (Met, M)
n = 18 (5.22%)
Proline (Pro, P)
n = 21 (6.09%)
Phenylalanine (Phe, F)
n = 11 (3.19%)
Tyrosine (Tyr, Y)
n = 8 (2.32%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 13 (3.77%)
Glutamine (Gln, Q)
n = 10 (2.9%)
Histidine (His, H)
n = 9 (2.61%)
Lysine (Lys, K)
n = 14 (4.06%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 24 14 11 17 24 5 8 8 2 0 3 4 1 2 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 2 12 12 1 2 5 5 0 3 8 10 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 11 1 4 13 10 1 0 5 1 7 2 2 2 11 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 5 0 0 1 12 2 0 2 2 0 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
53 101 124 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 116 60 138
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 146 133 46
ND3 (size: 1040 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.48%)
Alanine (Ala, A)
n = 27 (7.83%)
Serine (Ser, S)
n = 33 (9.57%)
Threonine (Thr, T)
n = 40 (11.59%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 8 (2.32%)
Leucine (Leu, L)
n = 67 (19.42%)
Isoleucine (Ile, I)
n = 34 (9.86%)
Methionine (Met, M)
n = 18 (5.22%)
Proline (Pro, P)
n = 21 (6.09%)
Phenylalanine (Phe, F)
n = 11 (3.19%)
Tyrosine (Tyr, Y)
n = 8 (2.32%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 13 (3.77%)
Glutamine (Gln, Q)
n = 10 (2.9%)
Histidine (His, H)
n = 9 (2.61%)
Lysine (Lys, K)
n = 14 (4.06%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 24 14 11 17 24 5 8 8 2 0 3 4 1 2 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 2 12 12 1 2 5 5 0 3 8 10 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 11 1 4 13 10 1 0 5 1 7 2 2 2 11 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 5 0 0 1 12 2 0 2 2 0 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
53 101 124 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 116 60 138
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 146 133 46
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.93%)
Alanine (Ala, A)
n = 39 (8.52%)
Serine (Ser, S)
n = 39 (8.52%)
Threonine (Thr, T)
n = 41 (8.95%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 13 (2.84%)
Leucine (Leu, L)
n = 98 (21.4%)
Isoleucine (Ile, I)
n = 41 (8.95%)
Methionine (Met, M)
n = 26 (5.68%)
Proline (Pro, P)
n = 27 (5.9%)
Phenylalanine (Phe, F)
n = 13 (2.84%)
Tyrosine (Tyr, Y)
n = 13 (2.84%)
Tryptophan (Trp, W)
n = 11 (2.4%)
Aspartic acid (Asp, D)
n = 2 (0.44%)
Glutamic acid (Glu, E)
n = 10 (2.18%)
Asparagine (Asn, N)
n = 16 (3.49%)
Glutamine (Gln, Q)
n = 14 (3.06%)
Histidine (His, H)
n = 14 (3.06%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 27 21 9 21 58 4 4 14 0 3 5 4 1 1 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 3 5 22 12 0 2 8 6 2 1 11 15 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 17 1 6 13 10 1 1 8 1 12 0 2 4 12 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 9 1 0 2 10 0 0 1 10 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
82 158 143 76
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 137 79 191
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 181 201 60
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 10 (10.2%)
Serine (Ser, S)
n = 12 (12.24%)
Threonine (Thr, T)
n = 8 (8.16%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 2 (2.04%)
Leucine (Leu, L)
n = 19 (19.39%)
Isoleucine (Ile, I)
n = 5 (5.1%)
Methionine (Met, M)
n = 7 (7.14%)
Proline (Pro, P)
n = 3 (3.06%)
Phenylalanine (Phe, F)
n = 5 (5.1%)
Tyrosine (Tyr, Y)
n = 3 (3.06%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 3 (3.06%)
Histidine (His, H)
n = 6 (6.12%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 4 6 1 4 12 1 1 3 0 0 0 1 1 1 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 3 0 8 2 0 0 3 1 0 0 1 2 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 2 0 0 6 2 0 1 3 0 3 0 0 0 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 2 0 0 1 0 0 0 0 2 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
19 32 26 22
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
14 29 18 38
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 53 38 5
ND5 (size: 1818 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 33 (5.45%)
Alanine (Ala, A)
n = 46 (7.6%)
Serine (Ser, S)
n = 56 (9.26%)
Threonine (Thr, T)
n = 65 (10.74%)
Cysteine (Cys, C)
n = 6 (0.99%)
Valine (Val, V)
n = 18 (2.98%)
Leucine (Leu, L)
n = 97 (16.03%)
Isoleucine (Ile, I)
n = 53 (8.76%)
Methionine (Met, M)
n = 35 (5.79%)
Proline (Pro, P)
n = 30 (4.96%)
Phenylalanine (Phe, F)
n = 37 (6.12%)
Tyrosine (Tyr, Y)
n = 14 (2.31%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 9 (1.49%)
Glutamic acid (Glu, E)
n = 12 (1.98%)
Asparagine (Asn, N)
n = 26 (4.3%)
Glutamine (Gln, Q)
n = 17 (2.81%)
Histidine (His, H)
n = 11 (1.82%)
Lysine (Lys, K)
n = 18 (2.98%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 36 32 9 14 63 4 7 16 1 3 5 10 0 6 31
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 3 3 5 28 13 0 4 4 22 3 6 11 13 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
32 24 0 5 21 16 1 0 13 3 11 1 0 6 20 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 12 0 3 6 18 0 1 1 6 0 1 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
118 156 211 119
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
73 184 107 240
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 245 264 82
ND6 (size: 519 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 29 (16.86%)
Alanine (Ala, A)
n = 12 (6.98%)
Serine (Ser, S)
n = 15 (8.72%)
Threonine (Thr, T)
n = 2 (1.16%)
Cysteine (Cys, C)
n = 2 (1.16%)
Valine (Val, V)
n = 35 (20.35%)
Leucine (Leu, L)
n = 31 (18.02%)
Isoleucine (Ile, I)
n = 3 (1.74%)
Methionine (Met, M)
n = 5 (2.91%)
Proline (Pro, P)
n = 4 (2.33%)
Phenylalanine (Phe, F)
n = 8 (4.65%)
Tyrosine (Tyr, Y)
n = 7 (4.07%)
Tryptophan (Trp, W)
n = 4 (2.33%)
Aspartic acid (Asp, D)
n = 4 (2.33%)
Glutamic acid (Glu, E)
n = 4 (2.33%)
Asparagine (Asn, N)
n = 2 (1.16%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 4 (2.33%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 0 2 5 0 1 2 7 0 0 16 0 7 12 6 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 0 5 0 2 5 8 0 3 17 1 0 1 2 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 1 5 1 2 3 3 1 5 2 4 16 1 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 2 4 0 0 0 1 0 2 1 0 0 0 1 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
83 16 16 56
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 29 18 82
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
69 7 29 66
Total protein-coding genes (size: 11395 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 219 (5.77%)
Alanine (Ala, A)
n = 306 (8.06%)
Serine (Ser, S)
n = 299 (7.88%)
Threonine (Thr, T)
n = 307 (8.09%)
Cysteine (Cys, C)
n = 28 (0.74%)
Valine (Val, V)
n = 201 (5.3%)
Leucine (Leu, L)
n = 663 (17.47%)
Isoleucine (Ile, I)
n = 291 (7.67%)
Methionine (Met, M)
n = 170 (4.48%)
Proline (Pro, P)
n = 222 (5.85%)
Phenylalanine (Phe, F)
n = 215 (5.66%)
Tyrosine (Tyr, Y)
n = 111 (2.92%)
Tryptophan (Trp, W)
n = 105 (2.77%)
Aspartic acid (Asp, D)
n = 67 (1.77%)
Glutamic acid (Glu, E)
n = 92 (2.42%)
Asparagine (Asn, N)
n = 137 (3.61%)
Glutamine (Gln, Q)
n = 94 (2.48%)
Histidine (His, H)
n = 103 (2.71%)
Lysine (Lys, K)
n = 83 (2.19%)
Arginine (Arg, R)
n = 71 (1.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
85 206 141 72 119 353 36 60 88 6 39 41 98 23 37 178
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
29 7 21 46 153 94 13 34 41 114 29 34 63 120 4 53
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
128 121 5 43 102 88 7 6 53 21 90 13 23 30 107 25
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
78 82 10 18 49 78 5 10 12 46 3 2 1 6 1 92
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
884 1069 1050 789
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
484 1074 694 1540
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
208 1441 1583 560

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.