Viewing data for Columba livia


Scientific name Columba livia
Common name Rock dove
Maximum lifespan 35.00 years (Columba livia@AnAge)

Total mtDNA (size: 17229 bases) GC AT G C A T
Base content (bases) 7904 9325 5496 2408 4131 5194
Base content per 1 kb (bases) 459 541 319 140 240 301
Base content (%) 45.9% 54.1%
Total protein-coding genes (size: 11366 bases) GC AT G C A T
Base content (bases) 5311 6055 3903 1408 2723 3332
Base content per 1 kb (bases) 467 533 343 124 240 293
Base content (%) 46.7% 53.3%
D-loop (size: 1657 bases) GC AT G C A T
Base content (bases) 692 965 472 220 454 511
Base content per 1 kb (bases) 418 582 285 133 274 308
Base content (%) 41.8% 58.2%
Total tRNA-coding genes (size: 1544 bases) GC AT G C A T
Base content (bases) 680 864 402 278 379 485
Base content per 1 kb (bases) 440 560 260 180 245 314
Base content (%) 44.0% 56.0%
Total rRNA-coding genes (size: 2559 bases) GC AT G C A T
Base content (bases) 1169 1390 672 497 552 838
Base content per 1 kb (bases) 457 543 263 194 216 327
Base content (%) 45.7% 54.3%
12S rRNA gene (size: 973 bases) GC AT G C A T
Base content (bases) 464 509 268 196 205 304
Base content per 1 kb (bases) 477 523 275 201 211 312
Base content (%) 47.7% 52.3%
16S rRNA gene (size: 1586 bases) GC AT G C A T
Base content (bases) 705 881 404 301 347 534
Base content per 1 kb (bases) 445 555 255 190 219 337
Base content (%) 44.5% 55.5%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 307 377 240 67 181 196
Base content per 1 kb (bases) 449 551 351 98 265 287
Base content (%) 44.9% 55.1%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 74 94 65 9 40 54
Base content per 1 kb (bases) 440 560 387 54 238 321
Base content (%) 44.0% 56.0%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 747 804 496 251 399 405
Base content per 1 kb (bases) 482 518 320 162 257 261
Base content (%) 48.2% 51.8%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 311 373 211 100 165 208
Base content per 1 kb (bases) 455 545 308 146 241 304
Base content (%) 45.5% 54.5%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 379 405 261 118 195 210
Base content per 1 kb (bases) 483 517 333 151 249 268
Base content (%) 48.3% 51.7%
CYTB (size: 1143 bases) GC AT G C A T
Base content (bases) 554 589 410 144 281 308
Base content per 1 kb (bases) 485 515 359 126 246 269
Base content (%) 48.5% 51.5%
ND1 (size: 966 bases) GC AT G C A T
Base content (bases) 456 510 331 125 259 251
Base content per 1 kb (bases) 472 528 343 129 268 260
Base content (%) 47.2% 52.8%
ND2 (size: 1040 bases) GC AT G C A T
Base content (bases) 462 578 356 106 249 329
Base content per 1 kb (bases) 444 556 342 102 239 316
Base content (%) 44.4% 55.6%
ND3 (size: 352 bases) GC AT G C A T
Base content (bases) 163 189 120 43 94 95
Base content per 1 kb (bases) 463 537 341 122 267 270
Base content (%) 46.3% 53.7%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 641 737 493 148 318 419
Base content per 1 kb (bases) 465 535 358 107 231 304
Base content (%) 46.5% 53.5%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 142 155 99 43 73 82
Base content per 1 kb (bases) 478 522 333 145 246 276
Base content (%) 47.8% 52.2%
ND5 (size: 1815 bases) GC AT G C A T
Base content (bases) 833 982 626 207 417 565
Base content per 1 kb (bases) 459 541 345 114 230 311
Base content (%) 45.9% 54.1%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 246 276 197 49 57 219
Base content per 1 kb (bases) 471 529 377 94 109 420
Base content (%) 47.1% 52.9%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 16 (7.05%)
Serine (Ser, S)
n = 12 (5.29%)
Threonine (Thr, T)
n = 25 (11.01%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 5 (2.2%)
Leucine (Leu, L)
n = 62 (27.31%)
Isoleucine (Ile, I)
n = 20 (8.81%)
Methionine (Met, M)
n = 9 (3.96%)
Proline (Pro, P)
n = 17 (7.49%)
Phenylalanine (Phe, F)
n = 9 (3.96%)
Tyrosine (Tyr, Y)
n = 4 (1.76%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 11 (4.85%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 4 (1.76%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 13 7 6 21 21 3 11 6 2 0 3 2 0 3 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 2 8 5 1 3 3 2 0 4 3 8 2 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 12 0 2 2 3 1 1 3 1 3 0 0 2 9 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 3 1 1 0 3 0 2 3 0 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
34 85 72 37
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
21 66 36 105
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 89 88 39
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPNPWFFIMLLSWLTFSLIIQPKLLSFTPTNPPSSKILTTTKSTPWTWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 6 (10.91%)
Threonine (Thr, T)
n = 9 (16.36%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 8 (14.55%)
Isoleucine (Ile, I)
n = 4 (7.27%)
Methionine (Met, M)
n = 2 (3.64%)
Proline (Pro, P)
n = 9 (16.36%)
Phenylalanine (Phe, F)
n = 4 (7.27%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 3 (5.45%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 3 (5.45%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 3 1 0 3 3 0 2 1 1 0 0 0 0 0 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 0 0 0 0 0 0 0 5 4 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 2 0 2 1 2 0 0 1 0 0 0 0 1 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 0 0 2 1 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
0 17 22 17
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 23 9 18
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 25 23 5
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.11%)
Alanine (Ala, A)
n = 47 (9.11%)
Serine (Ser, S)
n = 27 (5.23%)
Threonine (Thr, T)
n = 39 (7.56%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 34 (6.59%)
Leucine (Leu, L)
n = 63 (12.21%)
Isoleucine (Ile, I)
n = 42 (8.14%)
Methionine (Met, M)
n = 24 (4.65%)
Proline (Pro, P)
n = 31 (6.01%)
Phenylalanine (Phe, F)
n = 41 (7.95%)
Tyrosine (Tyr, Y)
n = 18 (3.49%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 15 (2.91%)
Glutamine (Gln, Q)
n = 9 (1.74%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 29 21 11 16 26 3 7 8 1 4 14 14 2 6 35
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 13 24 10 0 7 20 15 5 4 11 16 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 14 1 5 11 8 0 0 3 4 14 2 0 2 13 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 8 2 2 13 9 0 0 1 6 1 0 1 0 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
153 123 133 108
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 141 95 204
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 232 177 87
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 16 (7.05%)
Serine (Ser, S)
n = 20 (8.81%)
Threonine (Thr, T)
n = 13 (5.73%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 16 (7.05%)
Leucine (Leu, L)
n = 30 (13.22%)
Isoleucine (Ile, I)
n = 18 (7.93%)
Methionine (Met, M)
n = 10 (4.41%)
Proline (Pro, P)
n = 14 (6.17%)
Phenylalanine (Phe, F)
n = 9 (3.96%)
Tyrosine (Tyr, Y)
n = 8 (3.52%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 13 (5.73%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 4 (1.76%)
Glutamine (Gln, Q)
n = 7 (3.08%)
Histidine (His, H)
n = 9 (3.96%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 12 8 4 8 16 0 2 6 1 6 5 5 0 1 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 4 7 4 1 0 1 6 1 2 2 10 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 7 0 1 9 7 1 1 1 3 5 0 0 0 4 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 13 2 3 10 3 1 0 2 3 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 63 51 46
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
23 61 61 83
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 87 96 36
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.31%)
Alanine (Ala, A)
n = 23 (8.85%)
Serine (Ser, S)
n = 19 (7.31%)
Threonine (Thr, T)
n = 21 (8.08%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 13 (5.0%)
Leucine (Leu, L)
n = 35 (13.46%)
Isoleucine (Ile, I)
n = 16 (6.15%)
Methionine (Met, M)
n = 7 (2.69%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 10 (3.85%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 6 (2.31%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 15 (5.77%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 13 5 2 11 17 2 3 8 0 4 4 5 0 4 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 4 13 5 1 4 4 9 2 1 8 2 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 11 0 2 5 7 0 1 4 3 7 0 0 0 6 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 7 1 1 3 3 0 0 1 4 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 72 58 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 70 54 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 119 98 35
CYTB (size: 1143 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.32%)
Alanine (Ala, A)
n = 26 (6.84%)
Serine (Ser, S)
n = 22 (5.79%)
Threonine (Thr, T)
n = 30 (7.89%)
Cysteine (Cys, C)
n = 4 (1.05%)
Valine (Val, V)
n = 18 (4.74%)
Leucine (Leu, L)
n = 69 (18.16%)
Isoleucine (Ile, I)
n = 28 (7.37%)
Methionine (Met, M)
n = 9 (2.37%)
Proline (Pro, P)
n = 25 (6.58%)
Phenylalanine (Phe, F)
n = 27 (7.11%)
Tyrosine (Tyr, Y)
n = 15 (3.95%)
Tryptophan (Trp, W)
n = 10 (2.63%)
Aspartic acid (Asp, D)
n = 7 (1.84%)
Glutamic acid (Glu, E)
n = 7 (1.84%)
Asparagine (Asn, N)
n = 20 (5.26%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 12 (3.16%)
Lysine (Lys, K)
n = 10 (2.63%)
Arginine (Arg, R)
n = 9 (2.37%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 22 6 6 21 37 1 3 7 1 4 7 7 0 5 22
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 3 4 14 8 0 0 11 11 2 7 12 6 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 8 1 1 12 8 0 0 1 1 14 1 1 3 17 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 5 2 3 4 9 1 0 3 5 1 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
82 119 98 82
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
48 102 80 151
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 189 130 48
ND1 (size: 966 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (4.05%)
Alanine (Ala, A)
n = 29 (9.03%)
Serine (Ser, S)
n = 28 (8.72%)
Threonine (Thr, T)
n = 21 (6.54%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 14 (4.36%)
Leucine (Leu, L)
n = 63 (19.63%)
Isoleucine (Ile, I)
n = 24 (7.48%)
Methionine (Met, M)
n = 15 (4.67%)
Proline (Pro, P)
n = 24 (7.48%)
Phenylalanine (Phe, F)
n = 16 (4.98%)
Tyrosine (Tyr, Y)
n = 16 (4.98%)
Tryptophan (Trp, W)
n = 8 (2.49%)
Aspartic acid (Asp, D)
n = 4 (1.25%)
Glutamic acid (Glu, E)
n = 11 (3.43%)
Asparagine (Asn, N)
n = 12 (3.74%)
Glutamine (Gln, Q)
n = 5 (1.56%)
Histidine (His, H)
n = 2 (0.62%)
Lysine (Lys, K)
n = 7 (2.18%)
Arginine (Arg, R)
n = 8 (2.49%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 13 10 12 19 24 3 4 4 1 1 4 6 3 3 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 1 2 16 11 0 1 6 3 3 4 11 9 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 3 0 4 14 4 1 2 3 4 12 0 1 4 8 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 11 0 2 2 6 1 1 2 5 0 1 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 97 85 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 97 57 132
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 137 109 58
ND2 (size: 1040 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.48%)
Alanine (Ala, A)
n = 23 (6.67%)
Serine (Ser, S)
n = 29 (8.41%)
Threonine (Thr, T)
n = 56 (16.23%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 10 (2.9%)
Leucine (Leu, L)
n = 65 (18.84%)
Isoleucine (Ile, I)
n = 27 (7.83%)
Methionine (Met, M)
n = 22 (6.38%)
Proline (Pro, P)
n = 21 (6.09%)
Phenylalanine (Phe, F)
n = 12 (3.48%)
Tyrosine (Tyr, Y)
n = 7 (2.03%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 6 (1.74%)
Asparagine (Asn, N)
n = 11 (3.19%)
Glutamine (Gln, Q)
n = 8 (2.32%)
Histidine (His, H)
n = 10 (2.9%)
Lysine (Lys, K)
n = 11 (3.19%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 16 16 13 15 24 5 8 7 1 2 3 4 1 2 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 1 4 10 8 1 1 3 7 1 2 6 13 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
27 20 0 1 11 10 2 1 4 1 6 2 0 2 9 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 5 1 1 0 9 2 0 1 3 0 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
52 100 132 62
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 124 54 136
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 132 142 50
ND3 (size: 1040 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.48%)
Alanine (Ala, A)
n = 23 (6.67%)
Serine (Ser, S)
n = 29 (8.41%)
Threonine (Thr, T)
n = 56 (16.23%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 10 (2.9%)
Leucine (Leu, L)
n = 65 (18.84%)
Isoleucine (Ile, I)
n = 27 (7.83%)
Methionine (Met, M)
n = 22 (6.38%)
Proline (Pro, P)
n = 21 (6.09%)
Phenylalanine (Phe, F)
n = 12 (3.48%)
Tyrosine (Tyr, Y)
n = 7 (2.03%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 6 (1.74%)
Asparagine (Asn, N)
n = 11 (3.19%)
Glutamine (Gln, Q)
n = 8 (2.32%)
Histidine (His, H)
n = 10 (2.9%)
Lysine (Lys, K)
n = 11 (3.19%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 16 16 13 15 24 5 8 7 1 2 3 4 1 2 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 1 4 10 8 1 1 3 7 1 2 6 13 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
27 20 0 1 11 10 2 1 4 1 6 2 0 2 9 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 5 1 1 0 9 2 0 1 3 0 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
52 100 132 62
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 124 54 136
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 132 142 50
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.93%)
Alanine (Ala, A)
n = 32 (6.99%)
Serine (Ser, S)
n = 37 (8.08%)
Threonine (Thr, T)
n = 49 (10.7%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 7 (1.53%)
Leucine (Leu, L)
n = 98 (21.4%)
Isoleucine (Ile, I)
n = 41 (8.95%)
Methionine (Met, M)
n = 30 (6.55%)
Proline (Pro, P)
n = 29 (6.33%)
Phenylalanine (Phe, F)
n = 14 (3.06%)
Tyrosine (Tyr, Y)
n = 13 (2.84%)
Tryptophan (Trp, W)
n = 12 (2.62%)
Aspartic acid (Asp, D)
n = 2 (0.44%)
Glutamic acid (Glu, E)
n = 9 (1.97%)
Asparagine (Asn, N)
n = 15 (3.28%)
Glutamine (Gln, Q)
n = 12 (2.62%)
Histidine (His, H)
n = 16 (3.49%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 12 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 32 28 6 26 51 3 10 9 3 3 3 1 0 0 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 3 4 11 17 0 0 12 6 0 6 15 8 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
22 16 3 3 12 10 1 0 11 3 10 3 2 2 13 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 5 4 0 2 8 2 1 2 8 1 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 155 156 80
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
56 136 77 190
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 202 186 47
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 5 (5.1%)
Alanine (Ala, A)
n = 11 (11.22%)
Serine (Ser, S)
n = 12 (12.24%)
Threonine (Thr, T)
n = 7 (7.14%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 2 (2.04%)
Leucine (Leu, L)
n = 22 (22.45%)
Isoleucine (Ile, I)
n = 3 (3.06%)
Methionine (Met, M)
n = 6 (6.12%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 5 (5.1%)
Tyrosine (Tyr, Y)
n = 2 (2.04%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 3 (3.06%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 6 (6.12%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 3 4 0 5 12 2 3 2 0 0 0 2 0 0 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 0 7 4 0 1 2 2 0 2 0 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 2 1 2 1 5 1 1 2 0 2 0 0 1 2 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 2 1 1 0 0 0 0 0 2 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
22 31 22 24
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
14 29 18 38
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 39 42 11
ND5 (size: 1815 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 32 (5.3%)
Alanine (Ala, A)
n = 52 (8.61%)
Serine (Ser, S)
n = 48 (7.95%)
Threonine (Thr, T)
n = 70 (11.59%)
Cysteine (Cys, C)
n = 6 (0.99%)
Valine (Val, V)
n = 13 (2.15%)
Leucine (Leu, L)
n = 110 (18.21%)
Isoleucine (Ile, I)
n = 55 (9.11%)
Methionine (Met, M)
n = 27 (4.47%)
Proline (Pro, P)
n = 30 (4.97%)
Phenylalanine (Phe, F)
n = 28 (4.64%)
Tyrosine (Tyr, Y)
n = 12 (1.99%)
Tryptophan (Trp, W)
n = 11 (1.82%)
Aspartic acid (Asp, D)
n = 8 (1.32%)
Glutamic acid (Glu, E)
n = 14 (2.32%)
Asparagine (Asn, N)
n = 25 (4.14%)
Glutamine (Gln, Q)
n = 19 (3.15%)
Histidine (His, H)
n = 15 (2.48%)
Lysine (Lys, K)
n = 21 (3.48%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 40 23 10 32 55 6 6 17 2 1 6 3 3 5 23
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 3 3 10 24 18 0 3 15 13 1 8 7 14 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
32 31 1 4 23 11 0 2 8 2 10 0 1 6 19 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 14 0 2 6 21 0 2 1 4 1 1 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
119 175 209 102
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
68 190 114 233
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 261 242 82
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (16.18%)
Alanine (Ala, A)
n = 9 (5.2%)
Serine (Ser, S)
n = 14 (8.09%)
Threonine (Thr, T)
n = 4 (2.31%)
Cysteine (Cys, C)
n = 2 (1.16%)
Valine (Val, V)
n = 36 (20.81%)
Leucine (Leu, L)
n = 23 (13.29%)
Isoleucine (Ile, I)
n = 1 (0.58%)
Methionine (Met, M)
n = 8 (4.62%)
Proline (Pro, P)
n = 4 (2.31%)
Phenylalanine (Phe, F)
n = 16 (9.25%)
Tyrosine (Tyr, Y)
n = 7 (4.05%)
Tryptophan (Trp, W)
n = 5 (2.89%)
Aspartic acid (Asp, D)
n = 5 (2.89%)
Glutamic acid (Glu, E)
n = 4 (2.31%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 1 (0.58%)
Arginine (Arg, R)
n = 5 (2.89%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 0 0 2 0 2 1 3 0 0 15 3 6 12 16 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 1 1 2 0 2 5 7 2 2 17 4 0 0 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 1 7 0 2 1 4 0 5 2 3 15 1 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 4 5 0 0 1 3 0 0 2 0 0 0 1 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
82 14 19 59
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 27 19 84
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
71 8 19 76
Total protein-coding genes (size: 11383 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 219 (5.78%)
Alanine (Ala, A)
n = 291 (7.67%)
Serine (Ser, S)
n = 282 (7.44%)
Threonine (Thr, T)
n = 353 (9.31%)
Cysteine (Cys, C)
n = 26 (0.69%)
Valine (Val, V)
n = 171 (4.51%)
Leucine (Leu, L)
n = 678 (17.88%)
Isoleucine (Ile, I)
n = 288 (7.59%)
Methionine (Met, M)
n = 172 (4.54%)
Proline (Pro, P)
n = 225 (5.93%)
Phenylalanine (Phe, F)
n = 213 (5.62%)
Tyrosine (Tyr, Y)
n = 114 (3.01%)
Tryptophan (Trp, W)
n = 105 (2.77%)
Aspartic acid (Asp, D)
n = 64 (1.69%)
Glutamic acid (Glu, E)
n = 97 (2.56%)
Asparagine (Asn, N)
n = 129 (3.4%)
Glutamine (Gln, Q)
n = 92 (2.43%)
Histidine (His, H)
n = 108 (2.85%)
Lysine (Lys, K)
n = 83 (2.19%)
Arginine (Arg, R)
n = 73 (1.93%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
86 202 132 76 187 299 30 65 79 13 40 53 56 22 47 166
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
40 7 19 50 139 93 9 27 80 80 32 45 82 93 5 58
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
157 130 8 34 107 78 8 13 42 28 86 12 21 24 105 22
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
86 79 18 21 43 74 9 9 16 42 6 2 1 6 1 93
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
842 1090 1083 778
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
481 1096 694 1522
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
235 1570 1401 587

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.