Viewing data for Tachycineta bicolor


Scientific name Tachycineta bicolor
Common name Tree swallow
Maximum lifespan 12.10 years (Tachycineta bicolor@AnAge)

Total mtDNA (size: 17945 bases) GC AT G C A T
Base content (bases) 8331 9614 5812 2519 4116 5498
Base content per 1 kb (bases) 464 536 324 140 229 306
Base content (%) 46.4% 53.6%
Total protein-coding genes (size: 11379 bases) GC AT G C A T
Base content (bases) 5377 6002 3976 1401 2581 3421
Base content per 1 kb (bases) 473 527 349 123 227 301
Base content (%) 47.3% 52.7%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1535 bases) GC AT G C A T
Base content (bases) 661 874 391 270 368 506
Base content per 1 kb (bases) 431 569 255 176 240 330
Base content (%) 43.1% 56.9%
Total rRNA-coding genes (size: 2576 bases) GC AT G C A T
Base content (bases) 1212 1364 674 538 510 854
Base content per 1 kb (bases) 470 530 262 209 198 332
Base content (%) 47.0% 53.0%
12S rRNA gene (size: 973 bases) GC AT G C A T
Base content (bases) 477 496 258 219 197 299
Base content per 1 kb (bases) 490 510 265 225 202 307
Base content (%) 49.0% 51.0%
16S rRNA gene (size: 1603 bases) GC AT G C A T
Base content (bases) 735 868 416 319 313 555
Base content per 1 kb (bases) 459 541 260 199 195 346
Base content (%) 45.9% 54.1%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 308 376 244 64 158 218
Base content per 1 kb (bases) 450 550 357 94 231 319
Base content (%) 45.0% 55.0%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 73 95 64 9 42 53
Base content per 1 kb (bases) 435 565 381 54 250 315
Base content (%) 43.5% 56.5%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 752 799 497 255 366 433
Base content per 1 kb (bases) 485 515 320 164 236 279
Base content (%) 48.5% 51.5%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 312 372 213 99 162 210
Base content per 1 kb (bases) 456 544 311 145 237 307
Base content (%) 45.6% 54.4%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 393 391 268 125 183 208
Base content per 1 kb (bases) 501 499 342 159 233 265
Base content (%) 50.1% 49.9%
CYTB (size: 1143 bases) GC AT G C A T
Base content (bases) 543 600 396 147 279 321
Base content per 1 kb (bases) 475 525 346 129 244 281
Base content (%) 47.5% 52.5%
ND1 (size: 978 bases) GC AT G C A T
Base content (bases) 463 515 333 130 239 276
Base content per 1 kb (bases) 473 527 340 133 244 282
Base content (%) 47.3% 52.7%
ND2 (size: 1041 bases) GC AT G C A T
Base content (bases) 477 564 374 103 245 319
Base content per 1 kb (bases) 458 542 359 99 235 306
Base content (%) 45.8% 54.2%
ND3 (size: 351 bases) GC AT G C A T
Base content (bases) 167 184 128 39 81 103
Base content per 1 kb (bases) 476 524 365 111 231 293
Base content (%) 47.6% 52.4%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 643 735 498 145 304 431
Base content per 1 kb (bases) 467 533 361 105 221 313
Base content (%) 46.7% 53.3%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 146 151 111 35 69 82
Base content per 1 kb (bases) 492 508 374 118 232 276
Base content (%) 49.2% 50.8%
ND5 (size: 1818 bases) GC AT G C A T
Base content (bases) 848 970 640 208 404 566
Base content per 1 kb (bases) 466 534 352 114 222 311
Base content (%) 46.6% 53.4%
ND6 (size: 519 bases) GC AT G C A T
Base content (bases) 257 262 213 44 53 209
Base content per 1 kb (bases) 495 505 410 85 102 403
Base content (%) 49.5% 50.5%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 13 (5.73%)
Serine (Ser, S)
n = 16 (7.05%)
Threonine (Thr, T)
n = 24 (10.57%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 6 (2.64%)
Leucine (Leu, L)
n = 59 (25.99%)
Isoleucine (Ile, I)
n = 21 (9.25%)
Methionine (Met, M)
n = 10 (4.41%)
Proline (Pro, P)
n = 15 (6.61%)
Phenylalanine (Phe, F)
n = 11 (4.85%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 3 (1.32%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 9 (3.96%)
Glutamine (Gln, Q)
n = 9 (3.96%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 16 9 3 11 35 5 5 8 1 0 2 3 1 0 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 2 7 4 0 1 2 5 0 2 5 8 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 10 0 0 5 6 1 0 4 0 3 0 0 0 9 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 4 0 0 3 4 0 0 1 4 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
34 86 72 36
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
21 64 36 107
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 94 110 15
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPTPWFFIMLISWLTFSLLIQPKVLTFLSTNPPSNKTLTTPTTPSWTWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 5 (9.09%)
Threonine (Thr, T)
n = 11 (20.0%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.82%)
Leucine (Leu, L)
n = 8 (14.55%)
Isoleucine (Ile, I)
n = 3 (5.45%)
Methionine (Met, M)
n = 2 (3.64%)
Proline (Pro, P)
n = 9 (16.36%)
Phenylalanine (Phe, F)
n = 4 (7.27%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 3 (5.45%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 2 (3.64%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 3 0 0 1 6 1 0 2 0 1 0 0 0 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 0 0 0 0 0 0 0 0 1 4 4 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 3 0 2 2 1 0 0 0 0 0 0 0 1 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 0 0 2 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
1 19 21 15
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 25 8 18
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 20 24 9
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.11%)
Alanine (Ala, A)
n = 48 (9.3%)
Serine (Ser, S)
n = 28 (5.43%)
Threonine (Thr, T)
n = 38 (7.36%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 34 (6.59%)
Leucine (Leu, L)
n = 61 (11.82%)
Isoleucine (Ile, I)
n = 42 (8.14%)
Methionine (Met, M)
n = 24 (4.65%)
Proline (Pro, P)
n = 30 (5.81%)
Phenylalanine (Phe, F)
n = 44 (8.53%)
Tyrosine (Tyr, Y)
n = 17 (3.29%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 14 (2.71%)
Glutamic acid (Glu, E)
n = 11 (2.13%)
Asparagine (Asn, N)
n = 15 (2.91%)
Glutamine (Gln, Q)
n = 9 (1.74%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 35 17 7 13 30 5 6 8 1 4 7 20 3 6 38
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 1 3 26 19 0 6 14 22 5 2 10 18 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 14 0 1 12 10 1 0 4 1 16 0 0 2 13 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
18 11 0 2 12 9 0 1 2 5 0 0 1 0 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
154 121 133 109
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
78 140 94 205
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
23 236 206 52
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 19 (8.37%)
Serine (Ser, S)
n = 18 (7.93%)
Threonine (Thr, T)
n = 18 (7.93%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 19 (8.37%)
Leucine (Leu, L)
n = 30 (13.22%)
Isoleucine (Ile, I)
n = 12 (5.29%)
Methionine (Met, M)
n = 10 (4.41%)
Proline (Pro, P)
n = 12 (5.29%)
Phenylalanine (Phe, F)
n = 8 (3.52%)
Tyrosine (Tyr, Y)
n = 8 (3.52%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 11 (4.85%)
Glutamic acid (Glu, E)
n = 10 (4.41%)
Asparagine (Asn, N)
n = 11 (4.85%)
Glutamine (Gln, Q)
n = 7 (3.08%)
Histidine (His, H)
n = 8 (3.52%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 6 8 5 3 16 2 4 5 2 3 7 9 0 2 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 4 10 5 0 2 3 2 1 2 4 6 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 8 0 2 7 6 0 0 3 0 8 0 0 4 7 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 10 0 0 11 4 0 0 3 3 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 59 58 44
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 64 60 79
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 90 92 39
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.31%)
Alanine (Ala, A)
n = 24 (9.23%)
Serine (Ser, S)
n = 16 (6.15%)
Threonine (Thr, T)
n = 20 (7.69%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 18 (6.92%)
Leucine (Leu, L)
n = 31 (11.92%)
Isoleucine (Ile, I)
n = 13 (5.0%)
Methionine (Met, M)
n = 8 (3.08%)
Proline (Pro, P)
n = 14 (5.38%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 6 (2.31%)
Glutamic acid (Glu, E)
n = 7 (2.69%)
Asparagine (Asn, N)
n = 3 (1.15%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 4 (1.54%)
Arginine (Arg, R)
n = 6 (2.31%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 10 7 3 8 12 2 6 6 1 2 7 8 1 2 22
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 1 14 9 0 1 8 10 0 1 5 8 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 8 0 2 6 4 0 1 3 1 10 2 0 2 1 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
16 5 2 0 6 4 0 0 2 4 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 69 52 66
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 70 55 94
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 129 101 22
CYTB (size: 1143 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.32%)
Alanine (Ala, A)
n = 27 (7.11%)
Serine (Ser, S)
n = 25 (6.58%)
Threonine (Thr, T)
n = 26 (6.84%)
Cysteine (Cys, C)
n = 4 (1.05%)
Valine (Val, V)
n = 18 (4.74%)
Leucine (Leu, L)
n = 68 (17.89%)
Isoleucine (Ile, I)
n = 33 (8.68%)
Methionine (Met, M)
n = 7 (1.84%)
Proline (Pro, P)
n = 25 (6.58%)
Phenylalanine (Phe, F)
n = 28 (7.37%)
Tyrosine (Tyr, Y)
n = 12 (3.16%)
Tryptophan (Trp, W)
n = 11 (2.89%)
Aspartic acid (Asp, D)
n = 9 (2.37%)
Glutamic acid (Glu, E)
n = 7 (1.84%)
Asparagine (Asn, N)
n = 19 (5.0%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 11 (2.89%)
Lysine (Lys, K)
n = 10 (2.63%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 28 6 6 17 36 4 4 7 1 2 7 9 0 3 25
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 4 4 14 9 0 1 9 14 0 2 8 12 3 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 10 0 1 12 11 0 0 1 3 9 1 1 3 16 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 6 1 2 7 8 2 3 0 5 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
85 115 96 85
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
48 102 77 154
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 179 148 40
ND1 (size: 978 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (4.0%)
Alanine (Ala, A)
n = 33 (10.15%)
Serine (Ser, S)
n = 26 (8.0%)
Threonine (Thr, T)
n = 20 (6.15%)
Cysteine (Cys, C)
n = 4 (1.23%)
Valine (Val, V)
n = 15 (4.62%)
Leucine (Leu, L)
n = 63 (19.38%)
Isoleucine (Ile, I)
n = 25 (7.69%)
Methionine (Met, M)
n = 11 (3.38%)
Proline (Pro, P)
n = 25 (7.69%)
Phenylalanine (Phe, F)
n = 18 (5.54%)
Tyrosine (Tyr, Y)
n = 14 (4.31%)
Tryptophan (Trp, W)
n = 8 (2.46%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.38%)
Asparagine (Asn, N)
n = 12 (3.69%)
Glutamine (Gln, Q)
n = 6 (1.85%)
Histidine (His, H)
n = 2 (0.62%)
Lysine (Lys, K)
n = 7 (2.15%)
Arginine (Arg, R)
n = 8 (2.46%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 20 8 7 13 35 2 6 4 2 0 4 8 3 6 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 3 4 17 12 0 1 4 7 1 2 14 9 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 10 0 2 10 6 1 0 7 4 10 1 0 3 9 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 11 0 0 4 7 0 0 2 6 0 1 0 0 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
76 98 83 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
41 97 56 132
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 138 137 38
ND2 (size: 1041 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.47%)
Alanine (Ala, A)
n = 28 (8.09%)
Serine (Ser, S)
n = 30 (8.67%)
Threonine (Thr, T)
n = 45 (13.01%)
Cysteine (Cys, C)
n = 3 (0.87%)
Valine (Val, V)
n = 8 (2.31%)
Leucine (Leu, L)
n = 64 (18.5%)
Isoleucine (Ile, I)
n = 28 (8.09%)
Methionine (Met, M)
n = 17 (4.91%)
Proline (Pro, P)
n = 21 (6.07%)
Phenylalanine (Phe, F)
n = 17 (4.91%)
Tyrosine (Tyr, Y)
n = 6 (1.73%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 13 (3.76%)
Glutamine (Gln, Q)
n = 10 (2.89%)
Histidine (His, H)
n = 12 (3.47%)
Lysine (Lys, K)
n = 14 (4.05%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 22 14 7 14 30 6 6 9 1 1 4 3 0 0 17
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 2 3 13 12 0 1 3 7 1 6 8 7 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
23 13 1 3 15 6 1 0 5 2 4 2 1 2 11 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 3 1 1 0 14 0 0 0 3 0 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
53 103 122 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 119 61 134
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 152 136 42
ND3 (size: 1041 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.47%)
Alanine (Ala, A)
n = 28 (8.09%)
Serine (Ser, S)
n = 30 (8.67%)
Threonine (Thr, T)
n = 45 (13.01%)
Cysteine (Cys, C)
n = 3 (0.87%)
Valine (Val, V)
n = 8 (2.31%)
Leucine (Leu, L)
n = 64 (18.5%)
Isoleucine (Ile, I)
n = 28 (8.09%)
Methionine (Met, M)
n = 17 (4.91%)
Proline (Pro, P)
n = 21 (6.07%)
Phenylalanine (Phe, F)
n = 17 (4.91%)
Tyrosine (Tyr, Y)
n = 6 (1.73%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 13 (3.76%)
Glutamine (Gln, Q)
n = 10 (2.89%)
Histidine (His, H)
n = 12 (3.47%)
Lysine (Lys, K)
n = 14 (4.05%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 22 14 7 14 30 6 6 9 1 1 4 3 0 0 17
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 2 3 13 12 0 1 3 7 1 6 8 7 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
23 13 1 3 15 6 1 0 5 2 4 2 1 2 11 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 3 1 1 0 14 0 0 0 3 0 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
53 103 122 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 119 61 134
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 152 136 42
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (3.71%)
Alanine (Ala, A)
n = 37 (8.08%)
Serine (Ser, S)
n = 39 (8.52%)
Threonine (Thr, T)
n = 46 (10.04%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 8 (1.75%)
Leucine (Leu, L)
n = 96 (20.96%)
Isoleucine (Ile, I)
n = 41 (8.95%)
Methionine (Met, M)
n = 29 (6.33%)
Proline (Pro, P)
n = 30 (6.55%)
Phenylalanine (Phe, F)
n = 12 (2.62%)
Tyrosine (Tyr, Y)
n = 14 (3.06%)
Tryptophan (Trp, W)
n = 12 (2.62%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 10 (2.18%)
Asparagine (Asn, N)
n = 14 (3.06%)
Glutamine (Gln, Q)
n = 13 (2.84%)
Histidine (His, H)
n = 14 (3.06%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 34 27 10 25 47 6 8 11 2 1 3 4 0 0 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 3 3 18 16 0 0 8 9 0 4 17 9 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 23 2 4 11 14 0 1 9 3 11 1 0 3 11 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 8 2 0 3 8 2 0 3 8 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
75 156 150 78
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 142 78 186
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 200 203 39
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 9 (9.18%)
Serine (Ser, S)
n = 13 (13.27%)
Threonine (Thr, T)
n = 10 (10.2%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 2 (2.04%)
Leucine (Leu, L)
n = 21 (21.43%)
Isoleucine (Ile, I)
n = 3 (3.06%)
Methionine (Met, M)
n = 6 (6.12%)
Proline (Pro, P)
n = 3 (3.06%)
Phenylalanine (Phe, F)
n = 5 (5.1%)
Tyrosine (Tyr, Y)
n = 2 (2.04%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 3 (3.06%)
Histidine (His, H)
n = 6 (6.12%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 3 5 1 5 14 0 0 3 0 0 1 1 0 0 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 3 1 4 4 0 0 2 1 1 1 1 1 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 3 0 1 4 4 0 2 2 0 2 0 1 0 2 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 2 0 0 1 0 0 0 2 0 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
18 34 25 22
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
14 31 17 37
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 46 40 10
ND5 (size: 1818 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 33 (5.45%)
Alanine (Ala, A)
n = 46 (7.6%)
Serine (Ser, S)
n = 52 (8.6%)
Threonine (Thr, T)
n = 67 (11.07%)
Cysteine (Cys, C)
n = 6 (0.99%)
Valine (Val, V)
n = 20 (3.31%)
Leucine (Leu, L)
n = 109 (18.02%)
Isoleucine (Ile, I)
n = 53 (8.76%)
Methionine (Met, M)
n = 25 (4.13%)
Proline (Pro, P)
n = 30 (4.96%)
Phenylalanine (Phe, F)
n = 32 (5.29%)
Tyrosine (Tyr, Y)
n = 14 (2.31%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 8 (1.32%)
Glutamic acid (Glu, E)
n = 11 (1.82%)
Asparagine (Asn, N)
n = 26 (4.3%)
Glutamine (Gln, Q)
n = 19 (3.14%)
Histidine (His, H)
n = 13 (2.15%)
Lysine (Lys, K)
n = 20 (3.31%)
Arginine (Arg, R)
n = 9 (1.49%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 39 23 13 24 60 8 4 19 0 3 6 10 1 4 28
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 6 5 28 13 0 1 9 22 1 1 8 21 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
39 21 3 2 28 11 0 1 10 4 10 1 0 2 24 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 10 1 0 8 19 1 0 2 7 0 1 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
118 176 203 109
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
72 184 111 239
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 280 252 56
ND6 (size: 519 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 35 (20.35%)
Alanine (Ala, A)
n = 10 (5.81%)
Serine (Ser, S)
n = 14 (8.14%)
Threonine (Thr, T)
n = 2 (1.16%)
Cysteine (Cys, C)
n = 2 (1.16%)
Valine (Val, V)
n = 32 (18.6%)
Leucine (Leu, L)
n = 28 (16.28%)
Isoleucine (Ile, I)
n = 4 (2.33%)
Methionine (Met, M)
n = 5 (2.91%)
Proline (Pro, P)
n = 4 (2.33%)
Phenylalanine (Phe, F)
n = 10 (5.81%)
Tyrosine (Tyr, Y)
n = 7 (4.07%)
Tryptophan (Trp, W)
n = 5 (2.91%)
Aspartic acid (Asp, D)
n = 4 (2.33%)
Glutamic acid (Glu, E)
n = 3 (1.74%)
Asparagine (Asn, N)
n = 2 (1.16%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 1 (0.58%)
Arginine (Arg, R)
n = 4 (2.33%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 0 1 2 0 0 3 6 0 0 19 0 4 9 10 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 2 0 3 0 1 6 8 1 3 23 3 0 0 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 1 5 1 1 4 3 0 6 1 3 17 2 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 3 3 1 0 1 0 0 0 4 0 0 0 1 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
84 13 17 59
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
49 27 18 79
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
80 4 18 71
Total protein-coding genes (size: 11396 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 225 (5.93%)
Alanine (Ala, A)
n = 300 (7.9%)
Serine (Ser, S)
n = 289 (7.61%)
Threonine (Thr, T)
n = 340 (8.95%)
Cysteine (Cys, C)
n = 31 (0.82%)
Valine (Val, V)
n = 183 (4.82%)
Leucine (Leu, L)
n = 665 (17.51%)
Isoleucine (Ile, I)
n = 287 (7.56%)
Methionine (Met, M)
n = 159 (4.19%)
Proline (Pro, P)
n = 225 (5.93%)
Phenylalanine (Phe, F)
n = 221 (5.82%)
Tyrosine (Tyr, Y)
n = 110 (2.9%)
Tryptophan (Trp, W)
n = 107 (2.82%)
Aspartic acid (Asp, D)
n = 67 (1.76%)
Glutamic acid (Glu, E)
n = 86 (2.26%)
Asparagine (Asn, N)
n = 132 (3.48%)
Glutamine (Gln, Q)
n = 97 (2.55%)
Histidine (His, H)
n = 105 (2.77%)
Lysine (Lys, K)
n = 86 (2.26%)
Arginine (Arg, R)
n = 72 (1.9%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
62 225 130 66 144 335 44 56 86 11 36 48 81 18 38 183
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
29 5 26 33 153 106 8 22 65 104 34 27 90 104 4 43
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
164 126 7 26 116 82 8 8 49 24 86 11 20 24 108 13
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
92 76 10 8 59 80 6 4 17 47 4 2 1 7 1 96
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
861 1088 1064 785
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
495 1097 691 1515
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
216 1625 1518 439

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.