Viewing data for Acipenser stellatus


Scientific name Acipenser stellatus
Common name Star sturgeon
Maximum lifespan 27.00 years (Acipenser stellatus@AnAge)

Total mtDNA (size: 16537 bases) GC AT G C A T
Base content (bases) 7605 8924 4873 2732 3979 4945
Base content per 1 kb (bases) 460 540 295 165 241 299
Base content (%) 46.0% 54.0%
Total protein-coding genes (size: 11415 bases) GC AT G C A T
Base content (bases) 5349 6064 3600 1749 2797 3267
Base content per 1 kb (bases) 469 531 315 153 245 286
Base content (%) 46.9% 53.1%
D-loop (size: 822 bases) GC AT G C A T
Base content (bases) 295 526 177 118 255 271
Base content per 1 kb (bases) 359 640 215 144 310 330
Base content (%) 35.9% 64.0%
Total tRNA-coding genes (size: 1545 bases) GC AT G C A T
Base content (bases) 674 871 371 303 390 481
Base content per 1 kb (bases) 436 564 240 196 252 311
Base content (%) 43.6% 56.4%
Total rRNA-coding genes (size: 2663 bases) GC AT G C A T
Base content (bases) 1234 1424 692 542 521 903
Base content per 1 kb (bases) 463 535 260 204 196 339
Base content (%) 46.3% 53.5%
12S rRNA gene (size: 961 bases) GC AT G C A T
Base content (bases) 475 486 265 210 180 306
Base content per 1 kb (bases) 494 506 276 219 187 318
Base content (%) 49.4% 50.6%
16S rRNA gene (size: 1702 bases) GC AT G C A T
Base content (bases) 759 938 427 332 341 597
Base content per 1 kb (bases) 446 551 251 195 200 351
Base content (%) 44.6% 55.1%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 325 359 231 94 178 181
Base content per 1 kb (bases) 475 525 338 137 260 265
Base content (%) 47.5% 52.5%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 72 96 51 21 42 54
Base content per 1 kb (bases) 429 571 304 125 250 321
Base content (%) 42.9% 57.1%
COX1 (size: 1554 bases) GC AT G C A T
Base content (bases) 741 813 440 301 434 379
Base content per 1 kb (bases) 477 523 283 194 279 244
Base content (%) 47.7% 52.3%
COX2 (size: 691 bases) GC AT G C A T
Base content (bases) 312 379 191 121 169 210
Base content per 1 kb (bases) 452 548 276 175 245 304
Base content (%) 45.2% 54.8%
COX3 (size: 786 bases) GC AT G C A T
Base content (bases) 382 404 245 137 196 208
Base content per 1 kb (bases) 486 514 312 174 249 265
Base content (%) 48.6% 51.4%
CYTB (size: 1141 bases) GC AT G C A T
Base content (bases) 537 604 361 176 297 307
Base content per 1 kb (bases) 471 529 316 154 260 269
Base content (%) 47.1% 52.9%
ND1 (size: 975 bases) GC AT G C A T
Base content (bases) 450 525 310 140 246 279
Base content per 1 kb (bases) 462 538 318 144 252 286
Base content (%) 46.2% 53.8%
ND2 (size: 1045 bases) GC AT G C A T
Base content (bases) 477 568 339 138 236 332
Base content per 1 kb (bases) 456 544 324 132 226 318
Base content (%) 45.6% 54.4%
ND3 (size: 349 bases) GC AT G C A T
Base content (bases) 164 185 108 56 98 87
Base content per 1 kb (bases) 470 530 309 160 281 249
Base content (%) 47.0% 53.0%
ND4 (size: 1381 bases) GC AT G C A T
Base content (bases) 653 728 437 216 337 391
Base content per 1 kb (bases) 473 527 316 156 244 283
Base content (%) 47.3% 52.7%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 155 142 108 47 72 70
Base content per 1 kb (bases) 522 478 364 158 242 236
Base content (%) 52.2% 47.8%
ND5 (size: 1837 bases) GC AT G C A T
Base content (bases) 836 999 597 239 436 563
Base content per 1 kb (bases) 455 544 325 130 237 306
Base content (%) 45.5% 54.4%
ND6 (size: 525 bases) GC AT G C A T
Base content (bases) 250 275 185 65 61 214
Base content per 1 kb (bases) 476 524 352 124 116 408
Base content (%) 47.6% 52.4%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (5.29%)
Alanine (Ala, A)
n = 21 (9.25%)
Serine (Ser, S)
n = 7 (3.08%)
Threonine (Thr, T)
n = 19 (8.37%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 15 (6.61%)
Leucine (Leu, L)
n = 56 (24.67%)
Isoleucine (Ile, I)
n = 19 (8.37%)
Methionine (Met, M)
n = 9 (3.96%)
Proline (Pro, P)
n = 17 (7.49%)
Phenylalanine (Phe, F)
n = 10 (4.41%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.32%)
Asparagine (Asn, N)
n = 10 (4.41%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 5 (2.2%)
Lysine (Lys, K)
n = 1 (0.44%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 9 7 3 18 19 7 7 8 0 4 3 6 2 6 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 4 11 6 0 2 5 5 0 2 10 5 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 8 1 0 1 1 0 1 4 0 3 0 2 1 9 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 3 0 0 1 1 0 0 2 4 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
52 83 63 30
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
28 59 32 109
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 89 86 39
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPSPWFMILVFSWLIFLIVLPPKVLGHTFTNEPTHKNAEKIKPEPWTWPWS*
Amino acid frequencies:
Glycine (Gly, G)
n = 1 (1.82%)
Alanine (Ala, A)
n = 1 (1.82%)
Serine (Ser, S)
n = 3 (5.45%)
Threonine (Thr, T)
n = 4 (7.27%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 3 (5.45%)
Leucine (Leu, L)
n = 6 (10.91%)
Isoleucine (Ile, I)
n = 4 (7.27%)
Methionine (Met, M)
n = 2 (3.64%)
Proline (Pro, P)
n = 9 (16.36%)
Phenylalanine (Phe, F)
n = 4 (7.27%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 3 (5.45%)
Asparagine (Asn, N)
n = 3 (5.45%)
Glutamine (Gln, Q)
n = 1 (1.82%)
Histidine (His, H)
n = 2 (3.64%)
Lysine (Lys, K)
n = 4 (7.27%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 0 1 1 0 3 1 1 1 0 2 0 0 1 1 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 1 0 0 1 0 0 1 5 3 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 0 1 0 1 1 0 0 1 0 0 0 0 1 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 1 0 0 3 1 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
8 17 18 13
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
7 16 14 19
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 18 22 10
COX1 (size: 1554 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.09%)
Alanine (Ala, A)
n = 47 (9.09%)
Serine (Ser, S)
n = 30 (5.8%)
Threonine (Thr, T)
n = 36 (6.96%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 43 (8.32%)
Leucine (Leu, L)
n = 62 (11.99%)
Isoleucine (Ile, I)
n = 38 (7.35%)
Methionine (Met, M)
n = 25 (4.84%)
Proline (Pro, P)
n = 29 (5.61%)
Phenylalanine (Phe, F)
n = 41 (7.93%)
Tyrosine (Tyr, Y)
n = 19 (3.68%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.9%)
Glutamic acid (Glu, E)
n = 10 (1.93%)
Asparagine (Asn, N)
n = 14 (2.71%)
Glutamine (Gln, Q)
n = 8 (1.55%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 8 (1.55%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 17 12 9 9 23 9 10 5 3 6 11 16 10 18 23
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
13 0 1 7 27 9 4 7 17 18 5 8 10 9 2 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 15 4 5 9 9 2 0 5 9 10 2 2 5 9 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 8 2 4 11 6 2 2 2 3 1 0 0 1 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
162 114 126 116
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
78 137 94 209
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
61 189 159 109
COX2 (size: 691 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.93%)
Alanine (Ala, A)
n = 15 (6.55%)
Serine (Ser, S)
n = 17 (7.42%)
Threonine (Thr, T)
n = 11 (4.8%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 20 (8.73%)
Leucine (Leu, L)
n = 28 (12.23%)
Isoleucine (Ile, I)
n = 18 (7.86%)
Methionine (Met, M)
n = 12 (5.24%)
Proline (Pro, P)
n = 14 (6.11%)
Phenylalanine (Phe, F)
n = 8 (3.49%)
Tyrosine (Tyr, Y)
n = 10 (4.37%)
Tryptophan (Trp, W)
n = 5 (2.18%)
Aspartic acid (Asp, D)
n = 12 (5.24%)
Glutamic acid (Glu, E)
n = 16 (6.99%)
Asparagine (Asn, N)
n = 5 (2.18%)
Glutamine (Gln, Q)
n = 8 (3.49%)
Histidine (His, H)
n = 10 (4.37%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 6 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 7 6 4 5 11 4 4 8 0 1 5 8 6 2 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 1 2 6 5 2 0 3 4 2 2 5 6 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 7 1 3 6 5 0 1 2 4 6 0 0 2 3 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 14 2 1 11 4 0 0 1 5 0 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
72 62 53 43
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 54 65 86
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 75 92 39
COX3 (size: 786 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.66%)
Alanine (Ala, A)
n = 24 (9.2%)
Serine (Ser, S)
n = 12 (4.6%)
Threonine (Thr, T)
n = 23 (8.81%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 18 (6.9%)
Leucine (Leu, L)
n = 31 (11.88%)
Isoleucine (Ile, I)
n = 14 (5.36%)
Methionine (Met, M)
n = 9 (3.45%)
Proline (Pro, P)
n = 12 (4.6%)
Phenylalanine (Phe, F)
n = 23 (8.81%)
Tyrosine (Tyr, Y)
n = 12 (4.6%)
Tryptophan (Trp, W)
n = 12 (4.6%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 10 (3.83%)
Asparagine (Asn, N)
n = 2 (0.77%)
Glutamine (Gln, Q)
n = 9 (3.45%)
Histidine (His, H)
n = 14 (5.36%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 7 (2.68%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 8 7 8 4 11 5 3 9 0 1 10 6 1 11 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 2 2 10 10 2 0 8 8 4 1 6 5 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 10 1 3 3 3 0 0 3 2 10 0 0 0 2 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 9 1 3 2 2 0 0 3 4 0 0 0 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
77 70 53 62
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 68 55 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 107 100 39
CYTB (size: 1141 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (7.39%)
Alanine (Ala, A)
n = 28 (7.39%)
Serine (Ser, S)
n = 22 (5.8%)
Threonine (Thr, T)
n = 25 (6.6%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 24 (6.33%)
Leucine (Leu, L)
n = 61 (16.09%)
Isoleucine (Ile, I)
n = 28 (7.39%)
Methionine (Met, M)
n = 11 (2.9%)
Proline (Pro, P)
n = 21 (5.54%)
Phenylalanine (Phe, F)
n = 30 (7.92%)
Tyrosine (Tyr, Y)
n = 13 (3.43%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 4 (1.06%)
Asparagine (Asn, N)
n = 21 (5.54%)
Glutamine (Gln, Q)
n = 9 (2.37%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 19 8 12 14 21 6 6 6 3 0 8 10 6 11 19
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 3 2 18 8 0 3 8 14 3 2 8 9 2 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 14 0 3 10 8 0 0 1 4 9 1 2 5 16 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 4 0 1 10 7 2 0 0 7 1 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
95 103 95 87
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 95 79 154
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
29 163 133 55
ND1 (size: 975 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.56%)
Alanine (Ala, A)
n = 32 (9.88%)
Serine (Ser, S)
n = 20 (6.17%)
Threonine (Thr, T)
n = 21 (6.48%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 18 (5.56%)
Leucine (Leu, L)
n = 61 (18.83%)
Isoleucine (Ile, I)
n = 23 (7.1%)
Methionine (Met, M)
n = 14 (4.32%)
Proline (Pro, P)
n = 24 (7.41%)
Phenylalanine (Phe, F)
n = 17 (5.25%)
Tyrosine (Tyr, Y)
n = 14 (4.32%)
Tryptophan (Trp, W)
n = 8 (2.47%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.4%)
Asparagine (Asn, N)
n = 12 (3.7%)
Glutamine (Gln, Q)
n = 6 (1.85%)
Histidine (His, H)
n = 5 (1.54%)
Lysine (Lys, K)
n = 7 (2.16%)
Arginine (Arg, R)
n = 8 (2.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 16 11 4 12 31 3 9 5 1 3 5 9 1 8 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 0 4 15 12 1 2 9 5 2 2 8 13 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 8 0 3 7 6 1 1 2 3 11 1 2 4 8 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 9 2 0 4 7 0 0 1 7 0 0 0 0 1 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
83 93 80 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 94 60 133
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 123 139 44
ND2 (size: 1045 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.61%)
Alanine (Ala, A)
n = 38 (10.95%)
Serine (Ser, S)
n = 24 (6.92%)
Threonine (Thr, T)
n = 48 (13.83%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 9 (2.59%)
Leucine (Leu, L)
n = 62 (17.87%)
Isoleucine (Ile, I)
n = 27 (7.78%)
Methionine (Met, M)
n = 23 (6.63%)
Proline (Pro, P)
n = 18 (5.19%)
Phenylalanine (Phe, F)
n = 9 (2.59%)
Tyrosine (Tyr, Y)
n = 9 (2.59%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 6 (1.73%)
Asparagine (Asn, N)
n = 12 (3.46%)
Glutamine (Gln, Q)
n = 14 (4.03%)
Histidine (His, H)
n = 5 (1.44%)
Lysine (Lys, K)
n = 10 (2.88%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 13 19 8 12 28 7 7 12 2 1 3 4 1 4 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 0 3 22 12 1 2 7 6 1 1 9 8 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
22 15 6 1 6 7 2 4 4 4 5 1 0 3 9 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 4 2 0 2 10 0 0 0 4 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 96 128 53
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
40 120 58 130
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
27 123 146 52
ND3 (size: 1045 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.61%)
Alanine (Ala, A)
n = 38 (10.95%)
Serine (Ser, S)
n = 24 (6.92%)
Threonine (Thr, T)
n = 48 (13.83%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 9 (2.59%)
Leucine (Leu, L)
n = 62 (17.87%)
Isoleucine (Ile, I)
n = 27 (7.78%)
Methionine (Met, M)
n = 23 (6.63%)
Proline (Pro, P)
n = 18 (5.19%)
Phenylalanine (Phe, F)
n = 9 (2.59%)
Tyrosine (Tyr, Y)
n = 9 (2.59%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 6 (1.73%)
Asparagine (Asn, N)
n = 12 (3.46%)
Glutamine (Gln, Q)
n = 14 (4.03%)
Histidine (His, H)
n = 5 (1.44%)
Lysine (Lys, K)
n = 10 (2.88%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 13 19 8 12 28 7 7 12 2 1 3 4 1 4 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 0 3 22 12 1 2 7 6 1 1 9 8 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
22 15 6 1 6 7 2 4 4 4 5 1 0 3 9 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 4 2 0 2 10 0 0 0 4 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 96 128 53
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
40 120 58 130
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
27 123 146 52
ND4 (size: 1381 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (5.66%)
Alanine (Ala, A)
n = 43 (9.37%)
Serine (Ser, S)
n = 28 (6.1%)
Threonine (Thr, T)
n = 40 (8.71%)
Cysteine (Cys, C)
n = 6 (1.31%)
Valine (Val, V)
n = 16 (3.49%)
Leucine (Leu, L)
n = 88 (19.17%)
Isoleucine (Ile, I)
n = 42 (9.15%)
Methionine (Met, M)
n = 25 (5.45%)
Proline (Pro, P)
n = 27 (5.88%)
Phenylalanine (Phe, F)
n = 14 (3.05%)
Tyrosine (Tyr, Y)
n = 14 (3.05%)
Tryptophan (Trp, W)
n = 19 (4.14%)
Aspartic acid (Asp, D)
n = 3 (0.65%)
Glutamic acid (Glu, E)
n = 12 (2.61%)
Asparagine (Asn, N)
n = 14 (3.05%)
Glutamine (Gln, Q)
n = 12 (2.61%)
Histidine (His, H)
n = 9 (1.96%)
Lysine (Lys, K)
n = 11 (2.4%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 21 16 11 17 35 13 9 11 1 4 4 6 2 5 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 3 3 3 22 16 2 2 10 8 6 4 9 11 3 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
22 14 1 0 13 9 0 0 6 5 9 3 3 2 12 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 10 2 0 3 10 1 0 2 7 2 0 0 0 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
100 135 138 87
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
68 132 75 185
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
48 170 178 64
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 6 (6.12%)
Alanine (Ala, A)
n = 13 (13.27%)
Serine (Ser, S)
n = 9 (9.18%)
Threonine (Thr, T)
n = 8 (8.16%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 2 (2.04%)
Leucine (Leu, L)
n = 24 (24.49%)
Isoleucine (Ile, I)
n = 1 (1.02%)
Methionine (Met, M)
n = 6 (6.12%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 6 (6.12%)
Tyrosine (Tyr, Y)
n = 1 (1.02%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 3 (3.06%)
Histidine (His, H)
n = 5 (5.1%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 1 3 3 8 7 2 3 3 0 0 0 2 0 1 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 2 1 9 3 0 0 2 4 0 1 0 1 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 2 1 1 4 1 1 0 2 0 1 0 1 1 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 3 0 0 1 0 0 1 0 1 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
25 32 19 23
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
14 30 16 39
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 46 35 10
ND5 (size: 1837 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 31 (5.07%)
Alanine (Ala, A)
n = 51 (8.35%)
Serine (Ser, S)
n = 44 (7.2%)
Threonine (Thr, T)
n = 64 (10.47%)
Cysteine (Cys, C)
n = 7 (1.15%)
Valine (Val, V)
n = 21 (3.44%)
Leucine (Leu, L)
n = 94 (15.38%)
Isoleucine (Ile, I)
n = 56 (9.17%)
Methionine (Met, M)
n = 28 (4.58%)
Proline (Pro, P)
n = 30 (4.91%)
Phenylalanine (Phe, F)
n = 40 (6.55%)
Tyrosine (Tyr, Y)
n = 10 (1.64%)
Tryptophan (Trp, W)
n = 14 (2.29%)
Aspartic acid (Asp, D)
n = 12 (1.96%)
Glutamic acid (Glu, E)
n = 11 (1.8%)
Asparagine (Asn, N)
n = 30 (4.91%)
Glutamine (Gln, Q)
n = 22 (3.6%)
Histidine (His, H)
n = 15 (2.45%)
Lysine (Lys, K)
n = 21 (3.44%)
Arginine (Arg, R)
n = 9 (1.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
24 32 19 10 23 38 14 9 19 3 4 5 12 0 14 26
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 2 5 3 34 14 0 2 11 14 4 1 15 13 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
29 28 1 3 14 13 0 2 12 2 8 4 0 5 25 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 10 1 4 8 21 0 0 2 6 1 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
126 161 213 110
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
75 175 121 239
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
38 260 226 86
ND6 (size: 525 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (13.79%)
Alanine (Ala, A)
n = 16 (9.2%)
Serine (Ser, S)
n = 12 (6.9%)
Threonine (Thr, T)
n = 5 (2.87%)
Cysteine (Cys, C)
n = 1 (0.57%)
Valine (Val, V)
n = 29 (16.67%)
Leucine (Leu, L)
n = 32 (18.39%)
Isoleucine (Ile, I)
n = 5 (2.87%)
Methionine (Met, M)
n = 4 (2.3%)
Proline (Pro, P)
n = 4 (2.3%)
Phenylalanine (Phe, F)
n = 11 (6.32%)
Tyrosine (Tyr, Y)
n = 10 (5.75%)
Tryptophan (Trp, W)
n = 5 (2.87%)
Aspartic acid (Asp, D)
n = 5 (2.87%)
Glutamic acid (Glu, E)
n = 4 (2.3%)
Asparagine (Asn, N)
n = 1 (0.57%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 1 (0.57%)
Lysine (Lys, K)
n = 1 (0.57%)
Arginine (Arg, R)
n = 4 (2.3%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 0 1 6 1 0 5 9 0 0 8 3 4 14 10 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 0 9 0 2 5 7 0 2 15 4 0 0 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 1 1 5 1 1 3 2 0 9 1 5 11 0 1 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 4 4 1 0 1 1 0 0 3 0 0 0 1 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
78 21 18 58
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 35 23 81
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
71 9 20 75
Total protein-coding genes (size: 11433 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 244 (6.41%)
Alanine (Ala, A)
n = 341 (8.95%)
Serine (Ser, S)
n = 234 (6.14%)
Threonine (Thr, T)
n = 311 (8.17%)
Cysteine (Cys, C)
n = 29 (0.76%)
Valine (Val, V)
n = 223 (5.86%)
Leucine (Leu, L)
n = 632 (16.6%)
Isoleucine (Ile, I)
n = 283 (7.43%)
Methionine (Met, M)
n = 171 (4.49%)
Proline (Pro, P)
n = 215 (5.65%)
Phenylalanine (Phe, F)
n = 220 (5.78%)
Tyrosine (Tyr, Y)
n = 117 (3.07%)
Tryptophan (Trp, W)
n = 119 (3.13%)
Aspartic acid (Asp, D)
n = 75 (1.97%)
Glutamic acid (Glu, E)
n = 99 (2.6%)
Asparagine (Asn, N)
n = 128 (3.36%)
Glutamine (Gln, Q)
n = 103 (2.7%)
Histidine (His, H)
n = 102 (2.68%)
Lysine (Lys, K)
n = 79 (2.07%)
Arginine (Arg, R)
n = 75 (1.97%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
137 146 112 82 127 240 78 82 89 14 35 60 83 45 96 124
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
59 10 19 40 178 106 17 27 83 92 42 30 90 85 10 30
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
140 123 18 29 78 65 9 11 42 43 74 19 23 30 98 20
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
82 81 18 18 57 72 7 4 14 49 8 0 0 5 2 100
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
982 1022 1025 778
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
520 1048 710 1529
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
369 1412 1384 642

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.