Viewing data for Trionyx triunguis


Scientific name Trionyx triunguis
Common name African softshell turtle
Maximum lifespan 50.60 years (Trionyx triunguis@AnAge)

Total mtDNA (size: 16590 bases) GC AT G C A T
Base content (bases) 6888 9702 4864 2024 3840 5862
Base content per 1 kb (bases) 415 585 293 122 231 353
Base content (%) 41.5% 58.5%
Total protein-coding genes (size: 11319 bases) GC AT G C A T
Base content (bases) 4841 6478 3575 1266 2587 3891
Base content per 1 kb (bases) 428 572 316 112 229 344
Base content (%) 42.8% 57.2%
D-loop (size: 1078 bases) GC AT G C A T
Base content (bases) 355 723 256 99 337 386
Base content per 1 kb (bases) 329 671 237 92 313 358
Base content (%) 32.9% 67.1%
Total tRNA-coding genes (size: 1538 bases) GC AT G C A T
Base content (bases) 608 930 373 235 391 539
Base content per 1 kb (bases) 395 605 243 153 254 350
Base content (%) 39.5% 60.5%
Total rRNA-coding genes (size: 2585 bases) GC AT G C A T
Base content (bases) 1060 1525 645 415 511 1014
Base content per 1 kb (bases) 410 590 250 161 198 392
Base content (%) 41.0% 59.0%
12S rRNA gene (size: 977 bases) GC AT G C A T
Base content (bases) 415 562 254 161 197 365
Base content per 1 kb (bases) 425 575 260 165 202 374
Base content (%) 42.5% 57.5%
16S rRNA gene (size: 1608 bases) GC AT G C A T
Base content (bases) 645 963 391 254 314 649
Base content per 1 kb (bases) 401 599 243 158 195 404
Base content (%) 40.1% 59.9%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 294 390 237 57 150 240
Base content per 1 kb (bases) 430 570 346 83 219 351
Base content (%) 43.0% 57.0%
ATP8 (size: 165 bases) GC AT G C A T
Base content (bases) 59 106 52 7 37 69
Base content per 1 kb (bases) 358 642 315 42 224 418
Base content (%) 35.8% 64.2%
COX1 (size: 1539 bases) GC AT G C A T
Base content (bases) 669 870 422 247 418 452
Base content per 1 kb (bases) 435 565 274 160 272 294
Base content (%) 43.5% 56.5%
COX2 (size: 687 bases) GC AT G C A T
Base content (bases) 286 401 198 88 153 248
Base content per 1 kb (bases) 416 584 288 128 223 361
Base content (%) 41.6% 58.4%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 366 418 240 126 187 231
Base content per 1 kb (bases) 467 533 306 161 239 295
Base content (%) 46.7% 53.3%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 504 636 365 139 266 370
Base content per 1 kb (bases) 442 558 320 122 233 325
Base content (%) 44.2% 55.8%
ND1 (size: 972 bases) GC AT G C A T
Base content (bases) 423 549 317 106 240 309
Base content per 1 kb (bases) 435 565 326 109 247 318
Base content (%) 43.5% 56.5%
ND2 (size: 1039 bases) GC AT G C A T
Base content (bases) 409 630 323 86 235 395
Base content per 1 kb (bases) 394 606 311 83 226 380
Base content (%) 39.4% 60.6%
ND3 (size: 350 bases) GC AT G C A T
Base content (bases) 146 204 109 37 86 118
Base content per 1 kb (bases) 417 583 311 106 246 337
Base content (%) 41.7% 58.3%
ND4 (size: 1381 bases) GC AT G C A T
Base content (bases) 598 783 463 135 292 491
Base content per 1 kb (bases) 433 567 335 98 211 356
Base content (%) 43.3% 56.7%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 131 166 103 28 72 94
Base content per 1 kb (bases) 441 559 347 94 242 316
Base content (%) 44.1% 55.9%
ND5 (size: 1779 bases) GC AT G C A T
Base content (bases) 745 1034 565 180 406 628
Base content per 1 kb (bases) 419 581 318 101 228 353
Base content (%) 41.9% 58.1%
ND6 (size: 525 bases) GC AT G C A T
Base content (bases) 216 309 184 32 52 257
Base content per 1 kb (bases) 411 589 350 61 99 490
Base content (%) 41.1% 58.9%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 13 (5.73%)
Serine (Ser, S)
n = 11 (4.85%)
Threonine (Thr, T)
n = 32 (14.1%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 5 (2.2%)
Leucine (Leu, L)
n = 59 (25.99%)
Isoleucine (Ile, I)
n = 23 (10.13%)
Methionine (Met, M)
n = 10 (4.41%)
Proline (Pro, P)
n = 17 (7.49%)
Phenylalanine (Phe, F)
n = 5 (2.2%)
Tyrosine (Tyr, Y)
n = 2 (0.88%)
Tryptophan (Trp, W)
n = 3 (1.32%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 11 (4.85%)
Glutamine (Gln, Q)
n = 10 (4.41%)
Histidine (His, H)
n = 4 (1.76%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 17 9 1 6 42 4 6 10 0 2 0 3 0 1 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 3 9 1 0 0 2 6 0 1 6 10 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 14 1 2 2 4 0 0 3 1 1 1 0 1 10 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 4 0 0 1 4 0 0 1 4 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
31 89 83 25
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
19 70 37 102
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 78 120 23
ATP8 (size: 165 bases)
Amino acid sequence: MPQLNPNPWLSILLITWLTYITIHQPKIMSFSQTNNITNDPKYQITNPWNWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 3 (5.56%)
Threonine (Thr, T)
n = 7 (12.96%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 5 (9.26%)
Isoleucine (Ile, I)
n = 7 (12.96%)
Methionine (Met, M)
n = 2 (3.7%)
Proline (Pro, P)
n = 7 (12.96%)
Phenylalanine (Phe, F)
n = 1 (1.85%)
Tyrosine (Tyr, Y)
n = 2 (3.7%)
Tryptophan (Trp, W)
n = 5 (9.26%)
Aspartic acid (Asp, D)
n = 1 (1.85%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 7 (12.96%)
Glutamine (Gln, Q)
n = 4 (7.41%)
Histidine (His, H)
n = 1 (1.85%)
Lysine (Lys, K)
n = 2 (3.7%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 4 1 0 1 2 0 2 4 0 0 0 0 0 0 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 0 0 0 0 0 0 2 1 4 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 3 0 0 1 2 0 0 0 0 2 0 0 2 5 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 0 0 0 1 2 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
1 15 25 14
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 17 18 15
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
1 20 26 8
COX1 (size: 1539 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 45 (8.79%)
Alanine (Ala, A)
n = 40 (7.81%)
Serine (Ser, S)
n = 34 (6.64%)
Threonine (Thr, T)
n = 41 (8.01%)
Cysteine (Cys, C)
n = 1 (0.2%)
Valine (Val, V)
n = 39 (7.62%)
Leucine (Leu, L)
n = 59 (11.52%)
Isoleucine (Ile, I)
n = 39 (7.62%)
Methionine (Met, M)
n = 30 (5.86%)
Proline (Pro, P)
n = 26 (5.08%)
Phenylalanine (Phe, F)
n = 38 (7.42%)
Tyrosine (Tyr, Y)
n = 19 (3.71%)
Tryptophan (Trp, W)
n = 17 (3.32%)
Aspartic acid (Asp, D)
n = 15 (2.93%)
Glutamic acid (Glu, E)
n = 9 (1.76%)
Asparagine (Asn, N)
n = 15 (2.93%)
Glutamine (Gln, Q)
n = 8 (1.56%)
Histidine (His, H)
n = 20 (3.91%)
Lysine (Lys, K)
n = 9 (1.76%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 23 22 3 6 26 3 21 8 0 5 7 25 2 14 24
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 0 1 8 21 11 0 5 19 14 7 4 6 14 2 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 20 0 5 9 15 0 1 4 4 15 1 0 7 8 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 9 0 5 10 9 0 2 0 6 0 0 0 1 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
148 100 139 126
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 136 96 205
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
23 186 217 87
COX2 (size: 687 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.51%)
Alanine (Ala, A)
n = 11 (4.82%)
Serine (Ser, S)
n = 12 (5.26%)
Threonine (Thr, T)
n = 22 (9.65%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 11 (4.82%)
Leucine (Leu, L)
n = 26 (11.4%)
Isoleucine (Ile, I)
n = 22 (9.65%)
Methionine (Met, M)
n = 17 (7.46%)
Proline (Pro, P)
n = 14 (6.14%)
Phenylalanine (Phe, F)
n = 9 (3.95%)
Tyrosine (Tyr, Y)
n = 9 (3.95%)
Tryptophan (Trp, W)
n = 5 (2.19%)
Aspartic acid (Asp, D)
n = 9 (3.95%)
Glutamic acid (Glu, E)
n = 14 (6.14%)
Asparagine (Asn, N)
n = 9 (3.95%)
Glutamine (Gln, Q)
n = 7 (3.07%)
Histidine (His, H)
n = 11 (4.82%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 6 (2.63%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 18 13 3 2 13 3 5 5 2 1 2 8 0 2 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 2 2 6 3 0 1 1 6 0 1 2 11 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 11 1 0 3 8 0 1 0 2 7 0 0 2 7 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 13 1 1 8 3 1 0 1 4 1 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
53 59 75 42
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
22 58 64 85
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 81 109 26
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (8.08%)
Alanine (Ala, A)
n = 20 (7.69%)
Serine (Ser, S)
n = 15 (5.77%)
Threonine (Thr, T)
n = 28 (10.77%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 16 (6.15%)
Leucine (Leu, L)
n = 35 (13.46%)
Isoleucine (Ile, I)
n = 13 (5.0%)
Methionine (Met, M)
n = 9 (3.46%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 21 (8.08%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 4 (1.54%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 15 (5.77%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 6 7 5 6 17 2 5 7 1 0 8 8 0 4 17
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 2 1 11 7 1 3 6 7 5 0 2 10 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 17 0 1 1 9 0 1 3 3 8 0 0 0 4 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 7 1 1 3 1 1 0 0 5 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 70 60 62
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 71 52 94
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 99 119 30
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (6.86%)
Alanine (Ala, A)
n = 21 (5.54%)
Serine (Ser, S)
n = 25 (6.6%)
Threonine (Thr, T)
n = 33 (8.71%)
Cysteine (Cys, C)
n = 2 (0.53%)
Valine (Val, V)
n = 18 (4.75%)
Leucine (Leu, L)
n = 56 (14.78%)
Isoleucine (Ile, I)
n = 33 (8.71%)
Methionine (Met, M)
n = 20 (5.28%)
Proline (Pro, P)
n = 24 (6.33%)
Phenylalanine (Phe, F)
n = 25 (6.6%)
Tyrosine (Tyr, Y)
n = 15 (3.96%)
Tryptophan (Trp, W)
n = 11 (2.9%)
Aspartic acid (Asp, D)
n = 7 (1.85%)
Glutamic acid (Glu, E)
n = 4 (1.06%)
Asparagine (Asn, N)
n = 22 (5.8%)
Glutamine (Gln, Q)
n = 9 (2.37%)
Histidine (His, H)
n = 11 (2.9%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 28 19 4 4 36 3 8 9 0 0 4 13 1 2 23
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 1 0 15 6 0 2 9 12 3 1 5 16 2 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 11 1 2 8 12 1 0 2 4 11 1 1 1 21 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 4 0 0 7 9 0 0 1 7 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
76 99 119 86
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
49 101 78 152
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 165 173 28
ND1 (size: 972 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.95%)
Alanine (Ala, A)
n = 20 (6.19%)
Serine (Ser, S)
n = 30 (9.29%)
Threonine (Thr, T)
n = 28 (8.67%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 9 (2.79%)
Leucine (Leu, L)
n = 57 (17.65%)
Isoleucine (Ile, I)
n = 23 (7.12%)
Methionine (Met, M)
n = 22 (6.81%)
Proline (Pro, P)
n = 24 (7.43%)
Phenylalanine (Phe, F)
n = 22 (6.81%)
Tyrosine (Tyr, Y)
n = 12 (3.72%)
Tryptophan (Trp, W)
n = 8 (2.48%)
Aspartic acid (Asp, D)
n = 5 (1.55%)
Glutamic acid (Glu, E)
n = 11 (3.41%)
Asparagine (Asn, N)
n = 13 (4.02%)
Glutamine (Gln, Q)
n = 6 (1.86%)
Histidine (His, H)
n = 1 (0.31%)
Lysine (Lys, K)
n = 8 (2.48%)
Arginine (Arg, R)
n = 7 (2.17%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 17 19 3 9 38 2 5 5 1 0 0 9 0 0 22
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 3 12 5 0 2 9 4 1 1 10 13 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 15 0 3 12 13 1 0 1 3 9 1 0 4 9 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 8 3 1 4 8 0 0 0 7 0 0 0 1 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
61 90 95 78
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 101 57 133
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 126 157 29
ND2 (size: 1039 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.48%)
Alanine (Ala, A)
n = 22 (6.38%)
Serine (Ser, S)
n = 29 (8.41%)
Threonine (Thr, T)
n = 44 (12.75%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 5 (1.45%)
Leucine (Leu, L)
n = 61 (17.68%)
Isoleucine (Ile, I)
n = 31 (8.99%)
Methionine (Met, M)
n = 30 (8.7%)
Proline (Pro, P)
n = 19 (5.51%)
Phenylalanine (Phe, F)
n = 10 (2.9%)
Tyrosine (Tyr, Y)
n = 9 (2.61%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 20 (5.8%)
Glutamine (Gln, Q)
n = 13 (3.77%)
Histidine (His, H)
n = 7 (2.03%)
Lysine (Lys, K)
n = 13 (3.77%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 22 28 5 9 34 6 7 13 0 0 1 3 1 2 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 0 3 9 10 0 1 4 7 0 2 5 12 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 24 0 0 8 17 0 0 4 1 8 1 0 2 18 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 5 0 0 1 13 0 0 1 3 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
45 97 142 62
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 110 68 137
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 116 185 35
ND3 (size: 1039 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.48%)
Alanine (Ala, A)
n = 22 (6.38%)
Serine (Ser, S)
n = 29 (8.41%)
Threonine (Thr, T)
n = 44 (12.75%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 5 (1.45%)
Leucine (Leu, L)
n = 61 (17.68%)
Isoleucine (Ile, I)
n = 31 (8.99%)
Methionine (Met, M)
n = 30 (8.7%)
Proline (Pro, P)
n = 19 (5.51%)
Phenylalanine (Phe, F)
n = 10 (2.9%)
Tyrosine (Tyr, Y)
n = 9 (2.61%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 20 (5.8%)
Glutamine (Gln, Q)
n = 13 (3.77%)
Histidine (His, H)
n = 7 (2.03%)
Lysine (Lys, K)
n = 13 (3.77%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 22 28 5 9 34 6 7 13 0 0 1 3 1 2 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 0 3 9 10 0 1 4 7 0 2 5 12 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 24 0 0 8 17 0 0 4 1 8 1 0 2 18 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 5 0 0 1 13 0 0 1 3 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
45 97 142 62
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 110 68 137
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 116 185 35
ND4 (size: 1381 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (4.14%)
Alanine (Ala, A)
n = 27 (5.88%)
Serine (Ser, S)
n = 28 (6.1%)
Threonine (Thr, T)
n = 63 (13.73%)
Cysteine (Cys, C)
n = 4 (0.87%)
Valine (Val, V)
n = 7 (1.53%)
Leucine (Leu, L)
n = 89 (19.39%)
Isoleucine (Ile, I)
n = 42 (9.15%)
Methionine (Met, M)
n = 34 (7.41%)
Proline (Pro, P)
n = 30 (6.54%)
Phenylalanine (Phe, F)
n = 14 (3.05%)
Tyrosine (Tyr, Y)
n = 13 (2.83%)
Tryptophan (Trp, W)
n = 13 (2.83%)
Aspartic acid (Asp, D)
n = 3 (0.65%)
Glutamic acid (Glu, E)
n = 10 (2.18%)
Asparagine (Asn, N)
n = 19 (4.14%)
Glutamine (Gln, Q)
n = 13 (2.83%)
Histidine (His, H)
n = 13 (2.83%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 9 (1.96%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 34 32 5 10 58 8 7 12 1 1 2 4 0 4 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 4 1 19 7 0 0 8 9 2 0 12 17 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
24 37 0 2 5 15 0 1 5 2 11 2 1 2 17 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 10 0 1 2 10 0 0 1 7 1 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 146 174 74
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
51 142 81 186
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 175 236 31
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 2 (2.04%)
Alanine (Ala, A)
n = 6 (6.12%)
Serine (Ser, S)
n = 14 (14.29%)
Threonine (Thr, T)
n = 7 (7.14%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 1 (1.02%)
Leucine (Leu, L)
n = 22 (22.45%)
Isoleucine (Ile, I)
n = 5 (5.1%)
Methionine (Met, M)
n = 8 (8.16%)
Proline (Pro, P)
n = 5 (5.1%)
Phenylalanine (Phe, F)
n = 6 (6.12%)
Tyrosine (Tyr, Y)
n = 1 (1.02%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 6 (6.12%)
Glutamine (Gln, Q)
n = 4 (4.08%)
Histidine (His, H)
n = 4 (4.08%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 3 6 2 2 16 2 0 4 0 0 0 1 0 2 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 3 0 2 4 0 0 2 0 0 0 1 3 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 2 0 1 3 6 0 0 4 0 1 0 0 1 5 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 2 0 0 0 0 0 0 0 1 1 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
11 37 30 21
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
11 28 18 42
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 38 46 9
ND5 (size: 1779 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (4.05%)
Alanine (Ala, A)
n = 39 (6.59%)
Serine (Ser, S)
n = 52 (8.78%)
Threonine (Thr, T)
n = 80 (13.51%)
Cysteine (Cys, C)
n = 6 (1.01%)
Valine (Val, V)
n = 12 (2.03%)
Leucine (Leu, L)
n = 89 (15.03%)
Isoleucine (Ile, I)
n = 51 (8.61%)
Methionine (Met, M)
n = 40 (6.76%)
Proline (Pro, P)
n = 30 (5.07%)
Phenylalanine (Phe, F)
n = 31 (5.24%)
Tyrosine (Tyr, Y)
n = 11 (1.86%)
Tryptophan (Trp, W)
n = 12 (2.03%)
Aspartic acid (Asp, D)
n = 8 (1.35%)
Glutamic acid (Glu, E)
n = 11 (1.86%)
Asparagine (Asn, N)
n = 30 (5.07%)
Glutamine (Gln, Q)
n = 18 (3.04%)
Histidine (His, H)
n = 17 (2.87%)
Lysine (Lys, K)
n = 22 (3.72%)
Arginine (Arg, R)
n = 9 (1.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 38 38 7 14 55 3 9 17 1 1 4 4 3 10 21
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 3 3 4 18 17 0 1 4 14 5 5 7 17 1 12
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
34 33 1 3 12 25 0 1 11 2 9 3 1 6 24 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 10 1 2 6 20 2 0 3 6 0 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
94 153 235 111
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
63 189 118 223
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
23 223 275 72
ND6 (size: 525 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (14.37%)
Alanine (Ala, A)
n = 7 (4.02%)
Serine (Ser, S)
n = 12 (6.9%)
Threonine (Thr, T)
n = 3 (1.72%)
Cysteine (Cys, C)
n = 7 (4.02%)
Valine (Val, V)
n = 35 (20.11%)
Leucine (Leu, L)
n = 24 (13.79%)
Isoleucine (Ile, I)
n = 6 (3.45%)
Methionine (Met, M)
n = 5 (2.87%)
Proline (Pro, P)
n = 3 (1.72%)
Phenylalanine (Phe, F)
n = 16 (9.2%)
Tyrosine (Tyr, Y)
n = 12 (6.9%)
Tryptophan (Trp, W)
n = 6 (3.45%)
Aspartic acid (Asp, D)
n = 6 (3.45%)
Glutamic acid (Glu, E)
n = 2 (1.15%)
Asparagine (Asn, N)
n = 2 (1.15%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 3 (1.72%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 0 2 1 0 0 0 2 0 0 19 0 3 13 16 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 7 0 4 0 0 3 9 1 0 15 3 0 0 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 1 1 7 0 0 3 2 0 12 0 4 21 2 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 2 6 0 0 0 3 0 0 0 1 0 0 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
75 7 19 74
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 23 22 86
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
65 2 11 97
Total protein-coding genes (size: 11341 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 210 (5.56%)
Alanine (Ala, A)
n = 231 (6.11%)
Serine (Ser, S)
n = 270 (7.15%)
Threonine (Thr, T)
n = 402 (10.64%)
Cysteine (Cys, C)
n = 30 (0.79%)
Valine (Val, V)
n = 160 (4.24%)
Leucine (Leu, L)
n = 608 (16.09%)
Isoleucine (Ile, I)
n = 304 (8.05%)
Methionine (Met, M)
n = 233 (6.17%)
Proline (Pro, P)
n = 218 (5.77%)
Phenylalanine (Phe, F)
n = 207 (5.48%)
Tyrosine (Tyr, Y)
n = 118 (3.12%)
Tryptophan (Trp, W)
n = 106 (2.81%)
Aspartic acid (Asp, D)
n = 62 (1.64%)
Glutamic acid (Glu, E)
n = 86 (2.28%)
Asparagine (Asn, N)
n = 162 (4.29%)
Glutamine (Gln, Q)
n = 103 (2.73%)
Histidine (His, H)
n = 105 (2.78%)
Lysine (Lys, K)
n = 87 (2.3%)
Arginine (Arg, R)
n = 68 (1.8%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
86 218 200 40 76 349 39 80 97 6 30 28 82 20 60 147
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
33 12 18 29 123 75 4 24 66 82 38 20 57 133 8 40
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
164 193 5 27 65 129 5 7 37 35 83 15 24 30 132 22
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
83 78 8 17 45 83 4 5 9 51 3 1 0 8 0 91
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
749 998 1233 799
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
459 1077 731 1512
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
212 1351 1732 484

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.