Viewing data for Acomys cahirinus


Scientific name Acomys cahirinus
Common name Spiny mouse
Maximum lifespan 5.90 years (Acomys cahirinus@AnAge)

Total mtDNA (size: 16217 bases) GC AT G C A T
Base content (bases) 6585 9632 4511 2074 4216 5416
Base content per 1 kb (bases) 406 594 278 128 260 334
Base content (%) 40.6% 59.4%
Total protein-coding genes (size: 11329 bases) GC AT G C A T
Base content (bases) 4723 6606 3411 1312 2975 3631
Base content per 1 kb (bases) 417 583 301 116 263 321
Base content (%) 41.7% 58.3%
D-loop (size: 838 bases) GC AT G C A T
Base content (bases) 314 524 214 100 263 261
Base content per 1 kb (bases) 375 625 255 119 314 311
Base content (%) 37.5% 62.5%
Total tRNA-coding genes (size: 1492 bases) GC AT G C A T
Base content (bases) 557 935 332 225 394 541
Base content per 1 kb (bases) 373 627 223 151 264 363
Base content (%) 37.3% 62.7%
Total rRNA-coding genes (size: 2505 bases) GC AT G C A T
Base content (bases) 969 1536 540 429 572 964
Base content per 1 kb (bases) 387 613 216 171 228 385
Base content (%) 38.7% 61.3%
12S rRNA gene (size: 946 bases) GC AT G C A T
Base content (bases) 364 582 203 161 218 364
Base content per 1 kb (bases) 385 615 215 170 230 385
Base content (%) 38.5% 61.5%
16S rRNA gene (size: 1559 bases) GC AT G C A T
Base content (bases) 605 954 337 268 354 600
Base content per 1 kb (bases) 388 612 216 172 227 385
Base content (%) 38.8% 61.2%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 278 403 209 69 192 211
Base content per 1 kb (bases) 408 592 307 101 282 310
Base content (%) 40.8% 59.2%
ATP8 (size: 204 bases) GC AT G C A T
Base content (bases) 74 130 63 11 52 78
Base content per 1 kb (bases) 363 637 309 54 255 382
Base content (%) 36.3% 63.7%
COX1 (size: 1545 bases) GC AT G C A T
Base content (bases) 682 863 421 261 445 418
Base content per 1 kb (bases) 441 559 272 169 288 271
Base content (%) 44.1% 55.9%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 284 400 188 96 176 224
Base content per 1 kb (bases) 415 585 275 140 257 327
Base content (%) 41.5% 58.5%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 346 438 234 112 204 234
Base content per 1 kb (bases) 441 559 298 143 260 298
Base content (%) 44.1% 55.9%
CYTB (size: 1141 bases) GC AT G C A T
Base content (bases) 478 663 332 146 315 348
Base content per 1 kb (bases) 419 581 291 128 276 305
Base content (%) 41.9% 58.1%
ND1 (size: 955 bases) GC AT G C A T
Base content (bases) 410 545 303 107 258 287
Base content per 1 kb (bases) 429 571 317 112 270 301
Base content (%) 42.9% 57.1%
ND2 (size: 1037 bases) GC AT G C A T
Base content (bases) 426 611 344 82 242 369
Base content per 1 kb (bases) 411 589 332 79 233 356
Base content (%) 41.1% 58.9%
ND3 (size: 348 bases) GC AT G C A T
Base content (bases) 144 204 106 38 98 106
Base content per 1 kb (bases) 414 586 305 109 282 305
Base content (%) 41.4% 58.6%
ND4 (size: 1372 bases) GC AT G C A T
Base content (bases) 537 835 405 132 351 484
Base content per 1 kb (bases) 391 609 295 96 256 353
Base content (%) 39.1% 60.9%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 125 172 93 32 86 86
Base content per 1 kb (bases) 421 579 313 108 290 290
Base content (%) 42.1% 57.9%
ND5 (size: 1833 bases) GC AT G C A T
Base content (bases) 757 1076 564 193 477 599
Base content per 1 kb (bases) 413 587 308 105 260 327
Base content (%) 41.3% 58.7%
ND6 (size: 525 bases) GC AT G C A T
Base content (bases) 209 316 169 40 102 214
Base content per 1 kb (bases) 398 602 322 76 194 408
Base content (%) 39.8% 60.2%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 10 (4.42%)
Alanine (Ala, A)
n = 13 (5.75%)
Serine (Ser, S)
n = 14 (6.19%)
Threonine (Thr, T)
n = 21 (9.29%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (3.98%)
Leucine (Leu, L)
n = 43 (19.03%)
Isoleucine (Ile, I)
n = 30 (13.27%)
Methionine (Met, M)
n = 15 (6.64%)
Proline (Pro, P)
n = 14 (6.19%)
Phenylalanine (Phe, F)
n = 13 (5.75%)
Tyrosine (Tyr, Y)
n = 2 (0.88%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 2 (0.88%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 9 (3.98%)
Glutamine (Gln, Q)
n = 7 (3.1%)
Histidine (His, H)
n = 7 (3.1%)
Lysine (Lys, K)
n = 6 (2.65%)
Arginine (Arg, R)
n = 5 (2.21%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 10 12 3 11 25 0 3 7 0 1 1 6 1 6 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 4 6 3 0 2 3 5 0 3 8 2 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 8 1 2 2 5 0 0 5 2 0 1 1 2 7 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 3 0 1 1 5 1 0 4 1 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
37 72 86 32
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
23 57 37 110
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 80 88 50
ATP8 (size: 204 bases)
Amino acid sequence: MPQLDTSTWFITALSSTATLFILLQLKLSNIYYFNAPTPKTLKSLKTENPWEMKWTKIYSPHSLPPH*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 3 (4.48%)
Serine (Ser, S)
n = 7 (10.45%)
Threonine (Thr, T)
n = 9 (13.43%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 10 (14.93%)
Isoleucine (Ile, I)
n = 4 (5.97%)
Methionine (Met, M)
n = 2 (2.99%)
Proline (Pro, P)
n = 7 (10.45%)
Phenylalanine (Phe, F)
n = 3 (4.48%)
Tyrosine (Tyr, Y)
n = 3 (4.48%)
Tryptophan (Trp, W)
n = 3 (4.48%)
Aspartic acid (Asp, D)
n = 1 (1.49%)
Glutamic acid (Glu, E)
n = 2 (2.99%)
Asparagine (Asn, N)
n = 3 (4.48%)
Glutamine (Gln, Q)
n = 2 (2.99%)
Histidine (His, H)
n = 2 (2.99%)
Lysine (Lys, K)
n = 6 (8.96%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 3 1 1 1 6 0 2 2 0 0 0 0 0 2 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 1 2 0 0 0 0 0 1 5 1 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 4 1 1 2 4 0 0 0 2 1 0 0 2 1 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 1 0 6 0 0 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
6 19 24 19
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
3 26 20 19
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 18 34 14
COX1 (size: 1545 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 46 (8.95%)
Alanine (Ala, A)
n = 43 (8.37%)
Serine (Ser, S)
n = 32 (6.23%)
Threonine (Thr, T)
n = 33 (6.42%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 38 (7.39%)
Leucine (Leu, L)
n = 57 (11.09%)
Isoleucine (Ile, I)
n = 43 (8.37%)
Methionine (Met, M)
n = 30 (5.84%)
Proline (Pro, P)
n = 29 (5.64%)
Phenylalanine (Phe, F)
n = 42 (8.17%)
Tyrosine (Tyr, Y)
n = 20 (3.89%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 15 (2.92%)
Glutamic acid (Glu, E)
n = 9 (1.75%)
Asparagine (Asn, N)
n = 17 (3.31%)
Glutamine (Gln, Q)
n = 6 (1.17%)
Histidine (His, H)
n = 18 (3.5%)
Lysine (Lys, K)
n = 10 (1.95%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 20 22 7 14 20 4 12 6 0 5 8 19 6 20 22
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 0 1 12 17 14 0 4 9 23 10 7 13 9 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 10 2 7 8 13 1 2 1 4 16 1 0 6 11 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
16 7 2 5 10 9 1 2 1 5 0 0 0 1 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
151 106 136 122
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
75 134 96 210
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
35 181 186 113
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.96%)
Alanine (Ala, A)
n = 11 (4.85%)
Serine (Ser, S)
n = 22 (9.69%)
Threonine (Thr, T)
n = 16 (7.05%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 13 (5.73%)
Leucine (Leu, L)
n = 30 (13.22%)
Isoleucine (Ile, I)
n = 18 (7.93%)
Methionine (Met, M)
n = 15 (6.61%)
Proline (Pro, P)
n = 14 (6.17%)
Phenylalanine (Phe, F)
n = 7 (3.08%)
Tyrosine (Tyr, Y)
n = 9 (3.96%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 11 (4.85%)
Glutamic acid (Glu, E)
n = 13 (5.73%)
Asparagine (Asn, N)
n = 7 (3.08%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 7 (3.08%)
Lysine (Lys, K)
n = 5 (2.2%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 11 13 6 6 12 1 5 5 1 3 0 9 1 7 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 4 4 3 0 0 4 4 1 1 2 11 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 7 1 5 4 7 1 1 4 1 8 0 0 3 4 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 11 2 6 5 5 0 0 4 1 1 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
57 58 66 47
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
28 58 59 83
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 72 99 46
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (8.08%)
Alanine (Ala, A)
n = 15 (5.77%)
Serine (Ser, S)
n = 21 (8.08%)
Threonine (Thr, T)
n = 21 (8.08%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 13 (5.0%)
Leucine (Leu, L)
n = 33 (12.69%)
Isoleucine (Ile, I)
n = 18 (6.92%)
Methionine (Met, M)
n = 11 (4.23%)
Proline (Pro, P)
n = 10 (3.85%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 10 (3.85%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 7 (2.69%)
Asparagine (Asn, N)
n = 7 (2.69%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 4 (1.54%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 12 10 4 6 14 1 7 6 1 0 4 9 0 5 19
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 2 7 6 0 1 8 8 4 1 4 5 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 15 0 1 7 10 0 0 3 2 8 0 1 1 6 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 7 0 1 3 3 1 1 1 2 1 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
60 64 64 73
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 64 56 99
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 106 114 31
CYTB (size: 1141 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (6.6%)
Alanine (Ala, A)
n = 24 (6.33%)
Serine (Ser, S)
n = 24 (6.33%)
Threonine (Thr, T)
n = 23 (6.07%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 20 (5.28%)
Leucine (Leu, L)
n = 59 (15.57%)
Isoleucine (Ile, I)
n = 39 (10.29%)
Methionine (Met, M)
n = 17 (4.49%)
Proline (Pro, P)
n = 22 (5.8%)
Phenylalanine (Phe, F)
n = 27 (7.12%)
Tyrosine (Tyr, Y)
n = 14 (3.69%)
Tryptophan (Trp, W)
n = 11 (2.9%)
Aspartic acid (Asp, D)
n = 10 (2.64%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 18 (4.75%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 13 (3.43%)
Lysine (Lys, K)
n = 11 (2.9%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 24 16 7 10 26 0 14 5 1 1 3 14 2 6 21
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 3 6 7 11 0 2 9 10 4 2 11 8 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 13 0 5 7 9 0 0 3 7 7 0 2 2 16 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 6 0 2 8 11 0 0 3 5 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
85 92 111 92
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
50 90 78 162
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 150 159 60
ND1 (size: 955 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 10 (3.15%)
Alanine (Ala, A)
n = 24 (7.57%)
Serine (Ser, S)
n = 29 (9.15%)
Threonine (Thr, T)
n = 22 (6.94%)
Cysteine (Cys, C)
n = 1 (0.32%)
Valine (Val, V)
n = 13 (4.1%)
Leucine (Leu, L)
n = 56 (17.67%)
Isoleucine (Ile, I)
n = 26 (8.2%)
Methionine (Met, M)
n = 21 (6.62%)
Proline (Pro, P)
n = 23 (7.26%)
Phenylalanine (Phe, F)
n = 18 (5.68%)
Tyrosine (Tyr, Y)
n = 14 (4.42%)
Tryptophan (Trp, W)
n = 9 (2.84%)
Aspartic acid (Asp, D)
n = 4 (1.26%)
Glutamic acid (Glu, E)
n = 11 (3.47%)
Asparagine (Asn, N)
n = 12 (3.79%)
Glutamine (Gln, Q)
n = 5 (1.58%)
Histidine (His, H)
n = 5 (1.58%)
Lysine (Lys, K)
n = 7 (2.21%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 17 18 7 6 35 2 6 5 0 1 2 8 2 8 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 0 2 15 7 0 2 3 5 0 0 15 7 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 6 1 6 9 10 0 1 3 4 10 1 0 3 9 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 9 2 0 4 7 0 1 0 6 1 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
62 91 92 73
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 94 58 134
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 118 137 50
ND2 (size: 1037 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.78%)
Alanine (Ala, A)
n = 20 (5.81%)
Serine (Ser, S)
n = 30 (8.72%)
Threonine (Thr, T)
n = 36 (10.47%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 8 (2.33%)
Leucine (Leu, L)
n = 69 (20.06%)
Isoleucine (Ile, I)
n = 35 (10.17%)
Methionine (Met, M)
n = 29 (8.43%)
Proline (Pro, P)
n = 24 (6.98%)
Phenylalanine (Phe, F)
n = 10 (2.91%)
Tyrosine (Tyr, Y)
n = 8 (2.33%)
Tryptophan (Trp, W)
n = 8 (2.33%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 16 (4.65%)
Glutamine (Gln, Q)
n = 10 (2.91%)
Histidine (His, H)
n = 8 (2.33%)
Lysine (Lys, K)
n = 12 (3.49%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 19 29 3 17 42 0 7 10 0 1 1 5 1 3 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
0 0 0 0 11 9 0 0 3 8 2 2 14 7 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 19 0 2 10 11 1 0 6 0 8 0 0 2 14 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 5 0 0 1 12 0 0 1 2 0 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
47 107 134 57
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 104 60 151
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 133 174 33
ND3 (size: 1037 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.78%)
Alanine (Ala, A)
n = 20 (5.81%)
Serine (Ser, S)
n = 30 (8.72%)
Threonine (Thr, T)
n = 36 (10.47%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 8 (2.33%)
Leucine (Leu, L)
n = 69 (20.06%)
Isoleucine (Ile, I)
n = 35 (10.17%)
Methionine (Met, M)
n = 29 (8.43%)
Proline (Pro, P)
n = 24 (6.98%)
Phenylalanine (Phe, F)
n = 10 (2.91%)
Tyrosine (Tyr, Y)
n = 8 (2.33%)
Tryptophan (Trp, W)
n = 8 (2.33%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 16 (4.65%)
Glutamine (Gln, Q)
n = 10 (2.91%)
Histidine (His, H)
n = 8 (2.33%)
Lysine (Lys, K)
n = 12 (3.49%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 19 29 3 17 42 0 7 10 0 1 1 5 1 3 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
0 0 0 0 11 9 0 0 3 8 2 2 14 7 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 19 0 2 10 11 1 0 6 0 8 0 0 2 14 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 5 0 0 1 12 0 0 1 2 0 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
47 107 134 57
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 104 60 151
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 133 174 33
ND4 (size: 1372 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (3.51%)
Alanine (Ala, A)
n = 25 (5.48%)
Serine (Ser, S)
n = 43 (9.43%)
Threonine (Thr, T)
n = 41 (8.99%)
Cysteine (Cys, C)
n = 4 (0.88%)
Valine (Val, V)
n = 10 (2.19%)
Leucine (Leu, L)
n = 83 (18.2%)
Isoleucine (Ile, I)
n = 53 (11.62%)
Methionine (Met, M)
n = 39 (8.55%)
Proline (Pro, P)
n = 19 (4.17%)
Phenylalanine (Phe, F)
n = 15 (3.29%)
Tyrosine (Tyr, Y)
n = 14 (3.07%)
Tryptophan (Trp, W)
n = 13 (2.85%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 10 (2.19%)
Asparagine (Asn, N)
n = 23 (5.04%)
Glutamine (Gln, Q)
n = 10 (2.19%)
Histidine (His, H)
n = 13 (2.85%)
Lysine (Lys, K)
n = 14 (3.07%)
Arginine (Arg, R)
n = 9 (1.97%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 31 37 6 16 49 3 9 10 0 0 4 6 0 5 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 3 3 10 12 0 0 2 10 4 3 8 7 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 20 0 3 13 15 1 0 11 5 9 2 0 5 18 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 10 0 0 3 12 2 0 1 8 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
64 125 181 87
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 117 87 200
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 163 216 63
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 8 (8.16%)
Serine (Ser, S)
n = 13 (13.27%)
Threonine (Thr, T)
n = 8 (8.16%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 5 (5.1%)
Leucine (Leu, L)
n = 19 (19.39%)
Isoleucine (Ile, I)
n = 6 (6.12%)
Methionine (Met, M)
n = 7 (7.14%)
Proline (Pro, P)
n = 3 (3.06%)
Phenylalanine (Phe, F)
n = 6 (6.12%)
Tyrosine (Tyr, Y)
n = 3 (3.06%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 5 (5.1%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 1 (1.02%)
Lysine (Lys, K)
n = 1 (1.02%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 5 6 2 3 10 1 3 2 0 1 2 2 0 2 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 3 3 1 4 0 0 1 3 0 1 2 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 4 0 1 6 5 0 0 1 1 2 0 0 2 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 1 1 0 1 1 0 0 1 0 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
20 23 28 28
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 31 16 43
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 39 42 15
ND5 (size: 1833 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (4.26%)
Alanine (Ala, A)
n = 36 (5.9%)
Serine (Ser, S)
n = 54 (8.85%)
Threonine (Thr, T)
n = 65 (10.66%)
Cysteine (Cys, C)
n = 6 (0.98%)
Valine (Val, V)
n = 14 (2.3%)
Leucine (Leu, L)
n = 101 (16.56%)
Isoleucine (Ile, I)
n = 59 (9.67%)
Methionine (Met, M)
n = 35 (5.74%)
Proline (Pro, P)
n = 29 (4.75%)
Phenylalanine (Phe, F)
n = 34 (5.57%)
Tyrosine (Tyr, Y)
n = 17 (2.79%)
Tryptophan (Trp, W)
n = 14 (2.3%)
Aspartic acid (Asp, D)
n = 9 (1.48%)
Glutamic acid (Glu, E)
n = 12 (1.97%)
Asparagine (Asn, N)
n = 37 (6.07%)
Glutamine (Gln, Q)
n = 15 (2.46%)
Histidine (His, H)
n = 16 (2.62%)
Lysine (Lys, K)
n = 22 (3.61%)
Arginine (Arg, R)
n = 9 (1.48%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 42 33 8 18 50 8 16 14 1 2 3 7 2 16 18
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 6 5 15 16 0 2 7 11 6 6 11 12 0 12
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
34 17 2 8 18 16 0 3 9 8 9 1 1 10 27 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 8 4 3 6 21 1 0 3 5 1 0 0 1 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
97 153 230 131
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
67 172 129 243
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
29 239 240 103
ND6 (size: 525 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (15.52%)
Alanine (Ala, A)
n = 9 (5.17%)
Serine (Ser, S)
n = 13 (7.47%)
Threonine (Thr, T)
n = 6 (3.45%)
Cysteine (Cys, C)
n = 4 (2.3%)
Valine (Val, V)
n = 22 (12.64%)
Leucine (Leu, L)
n = 24 (13.79%)
Isoleucine (Ile, I)
n = 12 (6.9%)
Methionine (Met, M)
n = 12 (6.9%)
Proline (Pro, P)
n = 3 (1.72%)
Phenylalanine (Phe, F)
n = 7 (4.02%)
Tyrosine (Tyr, Y)
n = 12 (6.9%)
Tryptophan (Trp, W)
n = 6 (3.45%)
Aspartic acid (Asp, D)
n = 5 (2.87%)
Glutamic acid (Glu, E)
n = 8 (4.6%)
Asparagine (Asn, N)
n = 2 (1.15%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 1 (0.57%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 2 5 3 0 2 0 8 0 0 8 1 4 9 6 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 4 0 6 1 2 0 11 1 1 14 2 0 0 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 2 0 4 0 1 0 8 0 11 1 3 11 1 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 3 5 5 0 0 1 0 0 1 0 0 0 0 1 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 9 41 54
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
46 23 29 77
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
52 8 32 83
Total protein-coding genes (size: 11406 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 210 (5.53%)
Alanine (Ala, A)
n = 240 (6.32%)
Serine (Ser, S)
n = 307 (8.08%)
Threonine (Thr, T)
n = 309 (8.13%)
Cysteine (Cys, C)
n = 27 (0.71%)
Valine (Val, V)
n = 169 (4.45%)
Leucine (Leu, L)
n = 605 (15.93%)
Isoleucine (Ile, I)
n = 355 (9.34%)
Methionine (Met, M)
n = 239 (6.29%)
Proline (Pro, P)
n = 204 (5.37%)
Phenylalanine (Phe, F)
n = 214 (5.63%)
Tyrosine (Tyr, Y)
n = 131 (3.45%)
Tryptophan (Trp, W)
n = 105 (2.76%)
Aspartic acid (Asp, D)
n = 68 (1.79%)
Glutamic acid (Glu, E)
n = 94 (2.47%)
Asparagine (Asn, N)
n = 161 (4.24%)
Glutamine (Gln, Q)
n = 78 (2.05%)
Histidine (His, H)
n = 109 (2.87%)
Lysine (Lys, K)
n = 103 (2.71%)
Arginine (Arg, R)
n = 64 (1.68%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
154 201 208 61 114 300 22 92 74 4 23 31 91 24 90 124
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
31 8 19 47 101 92 0 24 52 89 45 29 99 69 7 50
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
121 130 8 45 88 109 4 15 46 49 82 9 16 40 121 20
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
89 76 18 25 43 96 7 4 20 36 4 0 0 7 1 96
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
781 952 1228 839
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
467 999 752 1582
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
200 1351 1565 684

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.