Viewing data for Choloepus didactylus


Scientific name Choloepus didactylus
Common name Linne's two-toed sloth
Maximum lifespan 36.80 years (Choloepus didactylus@AnAge)

Total mtDNA (size: 16543 bases) GC AT G C A T
Base content (bases) 7156 9384 4947 2209 3969 5415
Base content per 1 kb (bases) 433 567 299 134 240 327
Base content (%) 43.3% 56.7%
Total protein-coding genes (size: 11341 bases) GC AT G C A T
Base content (bases) 4930 6411 3596 1334 2773 3638
Base content per 1 kb (bases) 435 565 317 118 245 321
Base content (%) 43.5% 56.5%
D-loop (size: 1083 bases) GC AT G C A T
Base content (bases) 476 607 287 189 293 314
Base content per 1 kb (bases) 440 560 265 175 271 290
Base content (%) 44.0% 56.0%
Total tRNA-coding genes (size: 1520 bases) GC AT G C A T
Base content (bases) 595 924 358 237 385 539
Base content per 1 kb (bases) 391 608 236 156 253 355
Base content (%) 39.1% 60.8%
Total rRNA-coding genes (size: 2547 bases) GC AT G C A T
Base content (bases) 1131 1414 694 437 507 907
Base content per 1 kb (bases) 444 555 272 172 199 356
Base content (%) 44.4% 55.5%
12S rRNA gene (size: 964 bases) GC AT G C A T
Base content (bases) 426 538 261 165 189 349
Base content per 1 kb (bases) 442 558 271 171 196 362
Base content (%) 44.2% 55.8%
16S rRNA gene (size: 1583 bases) GC AT G C A T
Base content (bases) 705 876 433 272 318 558
Base content per 1 kb (bases) 445 553 274 172 201 352
Base content (%) 44.5% 55.3%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 300 381 218 82 171 210
Base content per 1 kb (bases) 441 559 320 120 251 308
Base content (%) 44.1% 55.9%
ATP8 (size: 192 bases) GC AT G C A T
Base content (bases) 78 114 65 13 40 74
Base content per 1 kb (bases) 406 594 339 68 208 385
Base content (%) 40.6% 59.4%
COX1 (size: 1542 bases) GC AT G C A T
Base content (bases) 686 856 423 263 428 428
Base content per 1 kb (bases) 445 555 274 171 278 278
Base content (%) 44.5% 55.5%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 293 391 201 92 165 226
Base content per 1 kb (bases) 428 572 294 135 241 330
Base content (%) 42.8% 57.2%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 350 434 231 119 211 223
Base content per 1 kb (bases) 446 554 295 152 269 284
Base content (%) 44.6% 55.4%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 501 639 369 132 271 368
Base content per 1 kb (bases) 439 561 324 116 238 323
Base content (%) 43.9% 56.1%
ND1 (size: 957 bases) GC AT G C A T
Base content (bases) 418 539 313 105 242 297
Base content per 1 kb (bases) 437 563 327 110 253 310
Base content (%) 43.7% 56.3%
ND2 (size: 1044 bases) GC AT G C A T
Base content (bases) 421 623 340 81 234 389
Base content per 1 kb (bases) 403 597 326 78 224 373
Base content (%) 40.3% 59.7%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 150 196 111 39 92 104
Base content per 1 kb (bases) 434 566 321 113 266 301
Base content (%) 43.4% 56.6%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 604 774 463 141 328 446
Base content per 1 kb (bases) 438 562 336 102 238 324
Base content (%) 43.8% 56.2%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 130 167 92 38 84 83
Base content per 1 kb (bases) 438 562 310 128 283 279
Base content (%) 43.8% 56.2%
ND5 (size: 1824 bases) GC AT G C A T
Base content (bases) 799 1025 599 200 442 583
Base content per 1 kb (bases) 438 562 328 110 242 320
Base content (%) 43.8% 56.2%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 224 304 187 37 80 224
Base content per 1 kb (bases) 424 576 354 70 152 424
Base content (%) 42.4% 57.6%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.87%)
Alanine (Ala, A)
n = 16 (7.08%)
Serine (Ser, S)
n = 14 (6.19%)
Threonine (Thr, T)
n = 25 (11.06%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 11 (4.87%)
Leucine (Leu, L)
n = 39 (17.26%)
Isoleucine (Ile, I)
n = 27 (11.95%)
Methionine (Met, M)
n = 15 (6.64%)
Proline (Pro, P)
n = 15 (6.64%)
Phenylalanine (Phe, F)
n = 12 (5.31%)
Tyrosine (Tyr, Y)
n = 3 (1.33%)
Tryptophan (Trp, W)
n = 2 (0.88%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 9 (3.98%)
Glutamine (Gln, Q)
n = 8 (3.54%)
Histidine (His, H)
n = 6 (2.65%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 5 (2.21%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 13 12 5 7 20 4 3 8 0 1 2 5 3 3 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 1 8 4 3 1 3 7 0 2 7 6 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 12 1 2 2 5 1 0 4 0 3 1 0 1 8 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 2 1 0 1 3 1 1 2 2 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
42 70 84 31
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
22 66 35 104
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 82 91 36
ATP8 (size: 192 bases)
Amino acid sequence: MPQLDTSTWSITILSTFISLFTLMQLKLTKHNFITPPTPKTPNTTKHTTPWEMKWTKTYSPLS*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 6 (9.52%)
Threonine (Thr, T)
n = 15 (23.81%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 7 (11.11%)
Isoleucine (Ile, I)
n = 4 (6.35%)
Methionine (Met, M)
n = 3 (4.76%)
Proline (Pro, P)
n = 7 (11.11%)
Phenylalanine (Phe, F)
n = 3 (4.76%)
Tyrosine (Tyr, Y)
n = 1 (1.59%)
Tryptophan (Trp, W)
n = 3 (4.76%)
Aspartic acid (Asp, D)
n = 1 (1.59%)
Glutamic acid (Glu, E)
n = 1 (1.59%)
Asparagine (Asn, N)
n = 2 (3.17%)
Glutamine (Gln, Q)
n = 2 (3.17%)
Histidine (His, H)
n = 2 (3.17%)
Lysine (Lys, K)
n = 6 (9.52%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 4 2 1 3 3 0 0 1 1 0 0 0 0 0 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 0 0 0 0 0 0 3 2 2 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 7 3 0 1 3 2 0 0 1 0 0 0 0 2 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 1 0 0 1 6 0 0 0 0 0 0 0 0 1 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
2 18 30 14
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
3 28 16 17
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 19 28 9
COX1 (size: 1542 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.16%)
Alanine (Ala, A)
n = 38 (7.41%)
Serine (Ser, S)
n = 30 (5.85%)
Threonine (Thr, T)
n = 38 (7.41%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 36 (7.02%)
Leucine (Leu, L)
n = 59 (11.5%)
Isoleucine (Ile, I)
n = 40 (7.8%)
Methionine (Met, M)
n = 35 (6.82%)
Proline (Pro, P)
n = 29 (5.65%)
Phenylalanine (Phe, F)
n = 44 (8.58%)
Tyrosine (Tyr, Y)
n = 18 (3.51%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 14 (2.73%)
Glutamic acid (Glu, E)
n = 10 (1.95%)
Asparagine (Asn, N)
n = 16 (3.12%)
Glutamine (Gln, Q)
n = 6 (1.17%)
Histidine (His, H)
n = 18 (3.51%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 17 25 6 9 23 7 11 4 2 2 10 21 3 14 30
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
10 0 1 7 16 15 0 7 20 18 2 5 8 15 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 15 5 2 8 14 3 0 3 6 12 2 3 4 12 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 9 1 5 9 8 1 0 5 2 1 0 0 0 1 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
145 106 141 122
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 132 92 214
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
42 185 195 92
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 7 (3.08%)
Serine (Ser, S)
n = 23 (10.13%)
Threonine (Thr, T)
n = 20 (8.81%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 8 (3.52%)
Leucine (Leu, L)
n = 35 (15.42%)
Isoleucine (Ile, I)
n = 18 (7.93%)
Methionine (Met, M)
n = 16 (7.05%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 6 (2.64%)
Tyrosine (Tyr, Y)
n = 9 (3.96%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 11 (4.85%)
Glutamic acid (Glu, E)
n = 14 (6.17%)
Asparagine (Asn, N)
n = 6 (2.64%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 9 (3.96%)
Lysine (Lys, K)
n = 5 (2.2%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 13 10 3 8 13 5 5 6 0 1 0 5 2 3 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 2 3 4 0 0 1 2 5 0 3 5 5 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 6 1 0 5 12 1 0 5 4 5 0 1 1 5 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 13 1 4 7 4 1 0 1 5 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
48 63 70 47
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 58 61 83
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 80 95 35
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 16 (6.15%)
Serine (Ser, S)
n = 22 (8.46%)
Threonine (Thr, T)
n = 20 (7.69%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 15 (5.77%)
Leucine (Leu, L)
n = 35 (13.46%)
Isoleucine (Ile, I)
n = 17 (6.54%)
Methionine (Met, M)
n = 9 (3.46%)
Proline (Pro, P)
n = 11 (4.23%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 10 (3.85%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 7 (2.69%)
Asparagine (Asn, N)
n = 6 (2.31%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 10 8 1 9 18 2 5 7 0 1 2 9 3 11 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 1 1 11 4 0 0 6 12 2 1 3 7 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 11 0 2 7 6 1 2 4 5 5 2 0 1 5 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 6 1 2 2 3 0 1 1 3 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
62 69 61 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
45 63 53 100
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 99 109 41
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.33%)
Alanine (Ala, A)
n = 19 (5.01%)
Serine (Ser, S)
n = 21 (5.54%)
Threonine (Thr, T)
n = 33 (8.71%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 11 (2.9%)
Leucine (Leu, L)
n = 54 (14.25%)
Isoleucine (Ile, I)
n = 41 (10.82%)
Methionine (Met, M)
n = 23 (6.07%)
Proline (Pro, P)
n = 25 (6.6%)
Phenylalanine (Phe, F)
n = 25 (6.6%)
Tyrosine (Tyr, Y)
n = 17 (4.49%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 10 (2.64%)
Glutamic acid (Glu, E)
n = 5 (1.32%)
Asparagine (Asn, N)
n = 18 (4.75%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 13 (3.43%)
Lysine (Lys, K)
n = 10 (2.64%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 30 21 3 12 30 4 5 6 0 1 2 8 0 9 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 4 0 9 9 1 1 11 11 1 3 7 13 2 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 16 0 0 7 10 1 1 2 2 15 1 0 2 16 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 5 0 1 9 10 0 0 4 4 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 101 128 82
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
51 95 80 154
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 173 160 35
ND1 (size: 957 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.77%)
Alanine (Ala, A)
n = 28 (8.81%)
Serine (Ser, S)
n = 23 (7.23%)
Threonine (Thr, T)
n = 33 (10.38%)
Cysteine (Cys, C)
n = 2 (0.63%)
Valine (Val, V)
n = 12 (3.77%)
Leucine (Leu, L)
n = 56 (17.61%)
Isoleucine (Ile, I)
n = 24 (7.55%)
Methionine (Met, M)
n = 13 (4.09%)
Proline (Pro, P)
n = 21 (6.6%)
Phenylalanine (Phe, F)
n = 21 (6.6%)
Tyrosine (Tyr, Y)
n = 10 (3.14%)
Tryptophan (Trp, W)
n = 9 (2.83%)
Aspartic acid (Asp, D)
n = 4 (1.26%)
Glutamic acid (Glu, E)
n = 11 (3.46%)
Asparagine (Asn, N)
n = 12 (3.77%)
Glutamine (Gln, Q)
n = 6 (1.89%)
Histidine (His, H)
n = 6 (1.89%)
Lysine (Lys, K)
n = 8 (2.52%)
Arginine (Arg, R)
n = 7 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 16 12 1 16 28 1 10 6 0 0 3 9 0 9 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 2 3 11 14 0 2 5 5 0 1 8 11 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 10 1 2 9 9 1 0 2 3 7 0 0 4 8 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 10 1 3 1 8 0 1 1 5 0 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 86 92 74
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 103 58 126
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 124 147 42
ND2 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.03%)
Alanine (Ala, A)
n = 17 (4.9%)
Serine (Ser, S)
n = 22 (6.34%)
Threonine (Thr, T)
n = 53 (15.27%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 8 (2.31%)
Leucine (Leu, L)
n = 57 (16.43%)
Isoleucine (Ile, I)
n = 36 (10.37%)
Methionine (Met, M)
n = 33 (9.51%)
Proline (Pro, P)
n = 26 (7.49%)
Phenylalanine (Phe, F)
n = 11 (3.17%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.88%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 5 (1.44%)
Asparagine (Asn, N)
n = 16 (4.61%)
Glutamine (Gln, Q)
n = 10 (2.88%)
Histidine (His, H)
n = 6 (1.73%)
Lysine (Lys, K)
n = 11 (3.17%)
Arginine (Arg, R)
n = 3 (0.86%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 26 32 4 15 31 3 4 9 1 1 0 7 0 4 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 1 9 7 0 0 3 10 1 1 10 15 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 29 0 2 8 11 0 0 1 3 5 0 0 2 14 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 4 1 0 0 11 0 0 1 2 0 0 0 0 1 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
44 98 150 56
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 117 57 145
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 125 182 33
ND3 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.03%)
Alanine (Ala, A)
n = 17 (4.9%)
Serine (Ser, S)
n = 22 (6.34%)
Threonine (Thr, T)
n = 53 (15.27%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 8 (2.31%)
Leucine (Leu, L)
n = 57 (16.43%)
Isoleucine (Ile, I)
n = 36 (10.37%)
Methionine (Met, M)
n = 33 (9.51%)
Proline (Pro, P)
n = 26 (7.49%)
Phenylalanine (Phe, F)
n = 11 (3.17%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.88%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 5 (1.44%)
Asparagine (Asn, N)
n = 16 (4.61%)
Glutamine (Gln, Q)
n = 10 (2.88%)
Histidine (His, H)
n = 6 (1.73%)
Lysine (Lys, K)
n = 11 (3.17%)
Arginine (Arg, R)
n = 3 (0.86%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 26 32 4 15 31 3 4 9 1 1 0 7 0 4 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 1 9 7 0 0 3 10 1 1 10 15 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 29 0 2 8 11 0 0 1 3 5 0 0 2 14 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 4 1 0 0 11 0 0 1 2 0 0 0 0 1 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
44 98 150 56
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 117 57 145
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 125 182 33
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (3.71%)
Alanine (Ala, A)
n = 24 (5.24%)
Serine (Ser, S)
n = 42 (9.17%)
Threonine (Thr, T)
n = 49 (10.7%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 9 (1.97%)
Leucine (Leu, L)
n = 93 (20.31%)
Isoleucine (Ile, I)
n = 44 (9.61%)
Methionine (Met, M)
n = 34 (7.42%)
Proline (Pro, P)
n = 25 (5.46%)
Phenylalanine (Phe, F)
n = 15 (3.28%)
Tyrosine (Tyr, Y)
n = 15 (3.28%)
Tryptophan (Trp, W)
n = 12 (2.62%)
Aspartic acid (Asp, D)
n = 4 (0.87%)
Glutamic acid (Glu, E)
n = 7 (1.53%)
Asparagine (Asn, N)
n = 23 (5.02%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 11 (2.4%)
Lysine (Lys, K)
n = 11 (2.4%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 28 30 5 24 49 9 5 10 1 0 1 6 2 4 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 3 0 14 9 1 0 6 10 1 2 9 13 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
24 17 2 3 13 15 2 2 7 1 14 2 1 6 17 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 5 2 1 3 10 1 0 5 5 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
61 144 170 84
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
51 131 82 195
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
29 188 194 48
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 10 (10.2%)
Serine (Ser, S)
n = 7 (7.14%)
Threonine (Thr, T)
n = 6 (6.12%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 6 (6.12%)
Leucine (Leu, L)
n = 27 (27.55%)
Isoleucine (Ile, I)
n = 4 (4.08%)
Methionine (Met, M)
n = 8 (8.16%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 3 (3.06%)
Tyrosine (Tyr, Y)
n = 4 (4.08%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 5 (5.1%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 3 (3.06%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 3 5 1 5 15 2 4 2 0 1 1 3 1 1 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 2 3 4 3 0 0 2 2 0 0 2 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 1 0 1 3 2 0 0 1 1 3 0 0 3 2 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 0 0 1 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
23 31 24 21
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 24 18 48
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 37 41 15
ND5 (size: 1824 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (4.61%)
Alanine (Ala, A)
n = 40 (6.59%)
Serine (Ser, S)
n = 47 (7.74%)
Threonine (Thr, T)
n = 65 (10.71%)
Cysteine (Cys, C)
n = 4 (0.66%)
Valine (Val, V)
n = 14 (2.31%)
Leucine (Leu, L)
n = 111 (18.29%)
Isoleucine (Ile, I)
n = 52 (8.57%)
Methionine (Met, M)
n = 30 (4.94%)
Proline (Pro, P)
n = 28 (4.61%)
Phenylalanine (Phe, F)
n = 36 (5.93%)
Tyrosine (Tyr, Y)
n = 14 (2.31%)
Tryptophan (Trp, W)
n = 13 (2.14%)
Aspartic acid (Asp, D)
n = 8 (1.32%)
Glutamic acid (Glu, E)
n = 11 (1.81%)
Asparagine (Asn, N)
n = 38 (6.26%)
Glutamine (Gln, Q)
n = 20 (3.29%)
Histidine (His, H)
n = 17 (2.8%)
Lysine (Lys, K)
n = 20 (3.29%)
Arginine (Arg, R)
n = 11 (1.81%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 34 22 13 29 49 6 13 20 0 1 2 9 2 10 26
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 0 4 3 16 17 4 0 10 16 2 4 7 15 2 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
34 22 3 8 17 12 1 3 6 5 9 2 1 4 34 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 9 2 2 6 19 1 0 6 5 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
101 173 214 120
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
65 171 129 243
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
34 255 240 79
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 33 (18.86%)
Alanine (Ala, A)
n = 8 (4.57%)
Serine (Ser, S)
n = 12 (6.86%)
Threonine (Thr, T)
n = 4 (2.29%)
Cysteine (Cys, C)
n = 5 (2.86%)
Valine (Val, V)
n = 30 (17.14%)
Leucine (Leu, L)
n = 22 (12.57%)
Isoleucine (Ile, I)
n = 6 (3.43%)
Methionine (Met, M)
n = 11 (6.29%)
Proline (Pro, P)
n = 3 (1.71%)
Phenylalanine (Phe, F)
n = 13 (7.43%)
Tyrosine (Tyr, Y)
n = 7 (4.0%)
Tryptophan (Trp, W)
n = 4 (2.29%)
Aspartic acid (Asp, D)
n = 3 (1.71%)
Glutamic acid (Glu, E)
n = 8 (4.57%)
Asparagine (Asn, N)
n = 2 (1.14%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 2 (1.14%)
Arginine (Arg, R)
n = 2 (1.14%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 0 4 3 0 0 3 6 0 0 16 1 5 8 13 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 4 1 6 0 0 2 15 2 4 12 2 0 1 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 1 5 0 1 0 6 0 6 1 2 10 2 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 7 3 0 1 1 1 0 1 0 0 1 0 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
82 11 32 51
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
51 21 22 82
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
54 5 26 91
Total protein-coding genes (size: 11397 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 222 (5.85%)
Alanine (Ala, A)
n = 233 (6.14%)
Serine (Ser, S)
n = 277 (7.3%)
Threonine (Thr, T)
n = 369 (9.72%)
Cysteine (Cys, C)
n = 28 (0.74%)
Valine (Val, V)
n = 162 (4.27%)
Leucine (Leu, L)
n = 624 (16.43%)
Isoleucine (Ile, I)
n = 321 (8.45%)
Methionine (Met, M)
n = 233 (6.14%)
Proline (Pro, P)
n = 212 (5.58%)
Phenylalanine (Phe, F)
n = 220 (5.79%)
Tyrosine (Tyr, Y)
n = 119 (3.13%)
Tryptophan (Trp, W)
n = 103 (2.71%)
Aspartic acid (Asp, D)
n = 63 (1.66%)
Glutamic acid (Glu, E)
n = 90 (2.37%)
Asparagine (Asn, N)
n = 159 (4.19%)
Glutamine (Gln, Q)
n = 87 (2.29%)
Histidine (His, H)
n = 107 (2.82%)
Lysine (Lys, K)
n = 92 (2.42%)
Arginine (Arg, R)
n = 67 (1.76%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
123 198 185 51 142 296 46 73 82 5 25 24 88 25 81 139
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
48 7 21 29 108 85 11 27 71 103 21 29 70 106 7 44
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
160 148 17 27 83 104 13 14 36 39 80 13 16 32 127 21
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
86 72 18 21 42 86 6 4 26 36 1 0 1 6 3 90
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
770 1008 1225 795
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
471 1041 726 1560
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
251 1413 1560 574

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.