Viewing data for Allocyttus niger


Scientific name Allocyttus niger
Common name Black oreo
Maximum lifespan 100.00 years (Allocyttus niger@AnAge)

Total mtDNA (size: 16750 bases) GC AT G C A T
Base content (bases) 7300 9450 4618 2682 4535 4915
Base content per 1 kb (bases) 436 564 276 160 271 293
Base content (%) 43.6% 56.4%
Total protein-coding genes (size: 11409 bases) GC AT G C A T
Base content (bases) 5025 6384 3349 1676 3228 3156
Base content per 1 kb (bases) 440 560 294 147 283 277
Base content (%) 44.0% 56.0%
D-loop (size: 1127 bases) GC AT G C A T
Base content (bases) 389 738 233 156 359 379
Base content per 1 kb (bases) 345 655 207 138 319 336
Base content (%) 34.5% 65.5%
Total tRNA-coding genes (size: 1549 bases) GC AT G C A T
Base content (bases) 686 863 383 303 377 486
Base content per 1 kb (bases) 443 557 247 196 243 314
Base content (%) 44.3% 55.7%
Total rRNA-coding genes (size: 2622 bases) GC AT G C A T
Base content (bases) 1180 1442 640 540 556 886
Base content per 1 kb (bases) 450 550 244 206 212 338
Base content (%) 45.0% 55.0%
12S rRNA gene (size: 946 bases) GC AT G C A T
Base content (bases) 458 488 253 205 190 298
Base content per 1 kb (bases) 484 516 267 217 201 315
Base content (%) 48.4% 51.6%
16S rRNA gene (size: 1676 bases) GC AT G C A T
Base content (bases) 722 954 387 335 366 588
Base content per 1 kb (bases) 431 569 231 200 218 351
Base content (%) 43.1% 56.9%

ATP6 (size: 683 bases) GC AT G C A T
Base content (bases) 288 395 204 84 221 174
Base content per 1 kb (bases) 422 578 299 123 324 255
Base content (%) 42.2% 57.8%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 72 96 54 18 40 56
Base content per 1 kb (bases) 429 571 321 107 238 333
Base content (%) 42.9% 57.1%
COX1 (size: 1563 bases) GC AT G C A T
Base content (bases) 676 887 391 285 479 408
Base content per 1 kb (bases) 433 567 250 182 306 261
Base content (%) 43.3% 56.7%
COX2 (size: 691 bases) GC AT G C A T
Base content (bases) 293 398 180 113 201 197
Base content per 1 kb (bases) 424 576 260 164 291 285
Base content (%) 42.4% 57.6%
COX3 (size: 785 bases) GC AT G C A T
Base content (bases) 359 426 228 131 231 195
Base content per 1 kb (bases) 457 543 290 167 294 248
Base content (%) 45.7% 54.3%
CYTB (size: 1141 bases) GC AT G C A T
Base content (bases) 505 636 328 177 332 304
Base content per 1 kb (bases) 443 557 287 155 291 266
Base content (%) 44.3% 55.7%
ND1 (size: 975 bases) GC AT G C A T
Base content (bases) 423 552 279 144 291 261
Base content per 1 kb (bases) 434 566 286 148 298 268
Base content (%) 43.4% 56.6%
ND2 (size: 1036 bases) GC AT G C A T
Base content (bases) 460 576 339 121 271 305
Base content per 1 kb (bases) 444 556 327 117 262 294
Base content (%) 44.4% 55.6%
ND3 (size: 349 bases) GC AT G C A T
Base content (bases) 161 188 108 53 107 81
Base content per 1 kb (bases) 461 539 309 152 307 232
Base content (%) 46.1% 53.9%
ND4 (size: 1382 bases) GC AT G C A T
Base content (bases) 610 772 418 192 392 380
Base content per 1 kb (bases) 441 559 302 139 284 275
Base content (%) 44.1% 55.9%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 145 152 101 44 85 67
Base content per 1 kb (bases) 488 512 340 148 286 226
Base content (%) 48.8% 51.2%
ND5 (size: 1839 bases) GC AT G C A T
Base content (bases) 796 1043 548 248 507 536
Base content per 1 kb (bases) 433 567 298 135 276 291
Base content (%) 43.3% 56.7%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 242 280 174 68 78 202
Base content per 1 kb (bases) 464 536 333 130 149 387
Base content (%) 46.4% 53.6%

ATP6 (size: 683 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.87%)
Alanine (Ala, A)
n = 17 (7.52%)
Serine (Ser, S)
n = 8 (3.54%)
Threonine (Thr, T)
n = 22 (9.73%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 12 (5.31%)
Leucine (Leu, L)
n = 55 (24.34%)
Isoleucine (Ile, I)
n = 21 (9.29%)
Methionine (Met, M)
n = 7 (3.1%)
Proline (Pro, P)
n = 17 (7.52%)
Phenylalanine (Phe, F)
n = 14 (6.19%)
Tyrosine (Tyr, Y)
n = 4 (1.77%)
Tryptophan (Trp, W)
n = 5 (2.21%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.77%)
Asparagine (Asn, N)
n = 9 (3.98%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 5 (2.21%)
Lysine (Lys, K)
n = 1 (0.44%)
Arginine (Arg, R)
n = 5 (2.21%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 4 5 8 16 11 1 17 7 2 1 4 3 4 8 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 6 8 3 0 3 5 3 0 2 8 6 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 8 0 1 1 2 0 1 3 3 1 0 2 6 3 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 3 1 0 1 1 0 0 2 2 1 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
45 72 64 46
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 60 33 109
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 72 76 65
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPAPWLMIFVFSWLVFLAVIPPKILAHNFTNEPTTQTTETMKPNPWNWPWH*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 3 (5.45%)
Serine (Ser, S)
n = 1 (1.82%)
Threonine (Thr, T)
n = 6 (10.91%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 3 (5.45%)
Leucine (Leu, L)
n = 5 (9.09%)
Isoleucine (Ile, I)
n = 3 (5.45%)
Methionine (Met, M)
n = 3 (5.45%)
Proline (Pro, P)
n = 9 (16.36%)
Phenylalanine (Phe, F)
n = 4 (7.27%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 2 (3.64%)
Asparagine (Asn, N)
n = 5 (9.09%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 2 (3.64%)
Lysine (Lys, K)
n = 2 (3.64%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 2 2 0 1 1 1 2 1 1 0 0 1 2 1 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 2 1 0 0 0 0 0 3 3 3 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 1 0 0 0 1 0 0 0 0 0 0 0 1 4 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 0 0 2 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
8 16 19 13
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 19 14 18
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 19 23 9
COX1 (size: 1563 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.04%)
Alanine (Ala, A)
n = 48 (9.23%)
Serine (Ser, S)
n = 32 (6.15%)
Threonine (Thr, T)
n = 34 (6.54%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 42 (8.08%)
Leucine (Leu, L)
n = 63 (12.12%)
Isoleucine (Ile, I)
n = 40 (7.69%)
Methionine (Met, M)
n = 24 (4.62%)
Proline (Pro, P)
n = 28 (5.38%)
Phenylalanine (Phe, F)
n = 42 (8.08%)
Tyrosine (Tyr, Y)
n = 18 (3.46%)
Tryptophan (Trp, W)
n = 17 (3.27%)
Aspartic acid (Asp, D)
n = 14 (2.69%)
Glutamic acid (Glu, E)
n = 12 (2.31%)
Asparagine (Asn, N)
n = 15 (2.88%)
Glutamine (Gln, Q)
n = 7 (1.35%)
Histidine (His, H)
n = 19 (3.65%)
Lysine (Lys, K)
n = 9 (1.73%)
Arginine (Arg, R)
n = 8 (1.54%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
31 9 17 16 15 14 1 17 6 1 11 8 19 4 30 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 1 11 21 16 0 4 12 14 17 6 11 6 5 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 23 1 6 5 15 0 2 4 7 11 1 0 8 7 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 9 3 5 9 9 0 2 1 4 1 0 1 0 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
163 108 129 121
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
80 136 94 211
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
42 147 185 147
COX2 (size: 691 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.93%)
Alanine (Ala, A)
n = 18 (7.86%)
Serine (Ser, S)
n = 16 (6.99%)
Threonine (Thr, T)
n = 8 (3.49%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 20 (8.73%)
Leucine (Leu, L)
n = 28 (12.23%)
Isoleucine (Ile, I)
n = 20 (8.73%)
Methionine (Met, M)
n = 11 (4.8%)
Proline (Pro, P)
n = 14 (6.11%)
Phenylalanine (Phe, F)
n = 9 (3.93%)
Tyrosine (Tyr, Y)
n = 8 (3.49%)
Tryptophan (Trp, W)
n = 5 (2.18%)
Aspartic acid (Asp, D)
n = 13 (5.68%)
Glutamic acid (Glu, E)
n = 15 (6.55%)
Asparagine (Asn, N)
n = 5 (2.18%)
Glutamine (Gln, Q)
n = 8 (3.49%)
Histidine (His, H)
n = 11 (4.8%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 6 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 4 8 10 4 9 1 4 8 0 8 3 7 2 6 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 1 3 7 7 1 1 3 2 3 2 7 5 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 3 1 1 9 3 0 2 1 6 2 1 0 4 1 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 14 1 3 10 4 0 1 1 4 0 0 0 0 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
75 63 51 41
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 53 64 88
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 64 82 71
COX3 (size: 785 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (8.08%)
Alanine (Ala, A)
n = 21 (8.08%)
Serine (Ser, S)
n = 13 (5.0%)
Threonine (Thr, T)
n = 25 (9.62%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 17 (6.54%)
Leucine (Leu, L)
n = 32 (12.31%)
Isoleucine (Ile, I)
n = 14 (5.38%)
Methionine (Met, M)
n = 8 (3.08%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 25 (9.62%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 7 (2.69%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 1 (0.38%)
Glutamine (Gln, Q)
n = 9 (3.46%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 4 6 16 6 6 1 3 8 1 6 5 5 1 13 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 2 5 7 8 1 0 9 7 5 2 7 3 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 13 1 4 3 3 0 0 3 5 6 1 0 1 0 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 7 1 3 4 2 0 0 0 5 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 71 53 63
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 68 54 96
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 89 87 71
CYTB (size: 1141 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (7.12%)
Alanine (Ala, A)
n = 32 (8.44%)
Serine (Ser, S)
n = 19 (5.01%)
Threonine (Thr, T)
n = 23 (6.07%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 27 (7.12%)
Leucine (Leu, L)
n = 63 (16.62%)
Isoleucine (Ile, I)
n = 30 (7.92%)
Methionine (Met, M)
n = 9 (2.37%)
Proline (Pro, P)
n = 22 (5.8%)
Phenylalanine (Phe, F)
n = 29 (7.65%)
Tyrosine (Tyr, Y)
n = 14 (3.69%)
Tryptophan (Trp, W)
n = 13 (3.43%)
Aspartic acid (Asp, D)
n = 10 (2.64%)
Glutamic acid (Glu, E)
n = 5 (1.32%)
Asparagine (Asn, N)
n = 18 (4.75%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 10 (2.64%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 15 6 15 9 19 5 13 6 0 5 5 13 4 16 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 3 6 14 10 2 2 10 12 3 3 12 7 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 12 0 1 8 8 0 1 1 5 9 0 2 4 14 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 4 1 5 5 9 1 0 1 5 2 0 0 0 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
101 96 92 91
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 94 75 158
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
23 138 137 82
ND1 (size: 975 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (5.25%)
Alanine (Ala, A)
n = 32 (9.88%)
Serine (Ser, S)
n = 25 (7.72%)
Threonine (Thr, T)
n = 22 (6.79%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 19 (5.86%)
Leucine (Leu, L)
n = 60 (18.52%)
Isoleucine (Ile, I)
n = 26 (8.02%)
Methionine (Met, M)
n = 11 (3.4%)
Proline (Pro, P)
n = 24 (7.41%)
Phenylalanine (Phe, F)
n = 18 (5.56%)
Tyrosine (Tyr, Y)
n = 12 (3.7%)
Tryptophan (Trp, W)
n = 8 (2.47%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.4%)
Asparagine (Asn, N)
n = 11 (3.4%)
Glutamine (Gln, Q)
n = 7 (2.16%)
Histidine (His, H)
n = 2 (0.62%)
Lysine (Lys, K)
n = 7 (2.16%)
Arginine (Arg, R)
n = 8 (2.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 12 9 9 12 18 3 17 7 0 5 4 9 1 12 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 3 16 12 1 1 2 6 8 8 11 4 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 2 0 4 5 11 0 1 4 8 4 1 1 6 5 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 10 1 2 2 5 2 0 0 6 2 0 0 1 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
83 83 82 77
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 98 55 134
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
23 98 124 80
ND2 (size: 1036 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (4.94%)
Alanine (Ala, A)
n = 32 (9.3%)
Serine (Ser, S)
n = 22 (6.4%)
Threonine (Thr, T)
n = 43 (12.5%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (2.62%)
Leucine (Leu, L)
n = 76 (22.09%)
Isoleucine (Ile, I)
n = 26 (7.56%)
Methionine (Met, M)
n = 19 (5.52%)
Proline (Pro, P)
n = 21 (6.1%)
Phenylalanine (Phe, F)
n = 9 (2.62%)
Tyrosine (Tyr, Y)
n = 6 (1.74%)
Tryptophan (Trp, W)
n = 11 (3.2%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 6 (1.74%)
Asparagine (Asn, N)
n = 12 (3.49%)
Glutamine (Gln, Q)
n = 14 (4.07%)
Histidine (His, H)
n = 7 (2.03%)
Lysine (Lys, K)
n = 10 (2.91%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 7 15 12 21 20 5 17 14 0 3 4 0 2 4 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 5 17 10 0 1 5 10 1 5 10 3 3 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 14 1 3 9 6 0 2 2 2 4 1 1 4 8 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 6 0 0 1 8 2 1 1 2 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
65 104 114 62
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 114 56 139
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 121 135 69
ND3 (size: 1036 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (4.94%)
Alanine (Ala, A)
n = 32 (9.3%)
Serine (Ser, S)
n = 22 (6.4%)
Threonine (Thr, T)
n = 43 (12.5%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (2.62%)
Leucine (Leu, L)
n = 76 (22.09%)
Isoleucine (Ile, I)
n = 26 (7.56%)
Methionine (Met, M)
n = 19 (5.52%)
Proline (Pro, P)
n = 21 (6.1%)
Phenylalanine (Phe, F)
n = 9 (2.62%)
Tyrosine (Tyr, Y)
n = 6 (1.74%)
Tryptophan (Trp, W)
n = 11 (3.2%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 6 (1.74%)
Asparagine (Asn, N)
n = 12 (3.49%)
Glutamine (Gln, Q)
n = 14 (4.07%)
Histidine (His, H)
n = 7 (2.03%)
Lysine (Lys, K)
n = 10 (2.91%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 7 15 12 21 20 5 17 14 0 3 4 0 2 4 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 5 17 10 0 1 5 10 1 5 10 3 3 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 14 1 3 9 6 0 2 2 2 4 1 1 4 8 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 6 0 0 1 8 2 1 1 2 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
65 104 114 62
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 114 56 139
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 121 135 69
ND4 (size: 1382 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (6.1%)
Alanine (Ala, A)
n = 36 (7.84%)
Serine (Ser, S)
n = 32 (6.97%)
Threonine (Thr, T)
n = 45 (9.8%)
Cysteine (Cys, C)
n = 5 (1.09%)
Valine (Val, V)
n = 13 (2.83%)
Leucine (Leu, L)
n = 90 (19.61%)
Isoleucine (Ile, I)
n = 38 (8.28%)
Methionine (Met, M)
n = 28 (6.1%)
Proline (Pro, P)
n = 27 (5.88%)
Phenylalanine (Phe, F)
n = 18 (3.92%)
Tyrosine (Tyr, Y)
n = 10 (2.18%)
Tryptophan (Trp, W)
n = 18 (3.92%)
Aspartic acid (Asp, D)
n = 3 (0.65%)
Glutamic acid (Glu, E)
n = 10 (2.18%)
Asparagine (Asn, N)
n = 12 (2.61%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 14 (3.05%)
Lysine (Lys, K)
n = 11 (2.4%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 15 22 15 24 19 4 27 8 3 3 2 7 1 13 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 4 8 18 9 1 4 10 11 3 6 15 6 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
23 15 1 8 8 7 0 2 7 5 5 7 1 5 7 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 6 4 0 3 11 0 0 5 6 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
90 125 143 102
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
71 131 71 187
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
31 162 165 102
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 6 (6.12%)
Alanine (Ala, A)
n = 14 (14.29%)
Serine (Ser, S)
n = 10 (10.2%)
Threonine (Thr, T)
n = 7 (7.14%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 2 (2.04%)
Leucine (Leu, L)
n = 22 (22.45%)
Isoleucine (Ile, I)
n = 3 (3.06%)
Methionine (Met, M)
n = 6 (6.12%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 6 (6.12%)
Tyrosine (Tyr, Y)
n = 1 (1.02%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 2 (2.04%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 1 (1.02%)
Glutamine (Gln, Q)
n = 3 (3.06%)
Histidine (His, H)
n = 4 (4.08%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 3 (3.06%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 2 4 5 6 6 0 5 3 0 0 1 1 0 3 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 1 2 10 2 0 2 2 1 1 0 2 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 2 0 2 2 4 0 0 2 1 0 0 0 1 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 2 0 1 1 0 0 0 1 2 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
26 29 19 25
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
15 31 14 39
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 41 34 21
ND5 (size: 1839 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 30 (4.9%)
Alanine (Ala, A)
n = 54 (8.82%)
Serine (Ser, S)
n = 44 (7.19%)
Threonine (Thr, T)
n = 59 (9.64%)
Cysteine (Cys, C)
n = 7 (1.14%)
Valine (Val, V)
n = 28 (4.58%)
Leucine (Leu, L)
n = 105 (17.16%)
Isoleucine (Ile, I)
n = 49 (8.01%)
Methionine (Met, M)
n = 26 (4.25%)
Proline (Pro, P)
n = 32 (5.23%)
Phenylalanine (Phe, F)
n = 38 (6.21%)
Tyrosine (Tyr, Y)
n = 10 (1.63%)
Tryptophan (Trp, W)
n = 13 (2.12%)
Aspartic acid (Asp, D)
n = 12 (1.96%)
Glutamic acid (Glu, E)
n = 12 (1.96%)
Asparagine (Asn, N)
n = 28 (4.58%)
Glutamine (Gln, Q)
n = 21 (3.43%)
Histidine (His, H)
n = 14 (2.29%)
Lysine (Lys, K)
n = 21 (3.43%)
Arginine (Arg, R)
n = 9 (1.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
33 16 19 16 20 43 10 15 17 4 8 5 12 3 18 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 1 6 4 26 20 4 6 11 8 5 6 16 10 0 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
28 19 2 9 14 8 0 2 11 5 5 1 1 15 13 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 10 2 7 5 20 1 0 2 7 0 0 0 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
136 165 196 116
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
72 176 119 246
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
40 207 221 145
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (16.18%)
Alanine (Ala, A)
n = 18 (10.4%)
Serine (Ser, S)
n = 11 (6.36%)
Threonine (Thr, T)
n = 2 (1.16%)
Cysteine (Cys, C)
n = 2 (1.16%)
Valine (Val, V)
n = 26 (15.03%)
Leucine (Leu, L)
n = 33 (19.08%)
Isoleucine (Ile, I)
n = 5 (2.89%)
Methionine (Met, M)
n = 5 (2.89%)
Proline (Pro, P)
n = 6 (3.47%)
Phenylalanine (Phe, F)
n = 9 (5.2%)
Tyrosine (Tyr, Y)
n = 10 (5.78%)
Tryptophan (Trp, W)
n = 6 (3.47%)
Aspartic acid (Asp, D)
n = 1 (0.58%)
Glutamic acid (Glu, E)
n = 5 (2.89%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 1 (0.58%)
Arginine (Arg, R)
n = 4 (2.31%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 0 3 11 0 0 2 11 0 0 10 1 10 5 9 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 0 9 0 2 7 2 3 6 17 1 0 3 2 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 1 8 0 2 0 1 0 6 4 3 9 0 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 3 1 0 1 0 1 0 1 2 0 1 0 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
78 23 16 57
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 36 18 78
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
54 9 44 67
Total protein-coding genes (size: 11431 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 247 (6.49%)
Alanine (Ala, A)
n = 333 (8.75%)
Serine (Ser, S)
n = 242 (6.36%)
Threonine (Thr, T)
n = 303 (7.96%)
Cysteine (Cys, C)
n = 26 (0.68%)
Valine (Val, V)
n = 222 (5.83%)
Leucine (Leu, L)
n = 661 (17.37%)
Isoleucine (Ile, I)
n = 283 (7.44%)
Methionine (Met, M)
n = 159 (4.18%)
Proline (Pro, P)
n = 222 (5.83%)
Phenylalanine (Phe, F)
n = 229 (6.02%)
Tyrosine (Tyr, Y)
n = 106 (2.79%)
Tryptophan (Trp, W)
n = 119 (3.13%)
Aspartic acid (Asp, D)
n = 72 (1.89%)
Glutamic acid (Glu, E)
n = 98 (2.57%)
Asparagine (Asn, N)
n = 121 (3.18%)
Glutamine (Gln, Q)
n = 100 (2.63%)
Histidine (His, H)
n = 106 (2.79%)
Lysine (Lys, K)
n = 79 (2.08%)
Arginine (Arg, R)
n = 73 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
189 94 117 138 143 170 37 156 88 12 62 43 88 29 137 92
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
42 8 18 65 148 103 17 26 75 83 63 45 106 58 13 48
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
132 115 8 48 68 72 0 14 40 55 51 17 17 55 66 30
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
76 79 19 28 44 72 7 5 15 45 8 0 2 4 0 102
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
972 989 1001 845
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
521 1046 686 1554
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
291 1211 1352 953

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.