Viewing data for Acipenser sturio


Scientific name Acipenser sturio
Common name Baltic sturgeon
Maximum lifespan 100.00 years (Acipenser sturio@AnAge)

Total mtDNA (size: 16555 bases) GC AT G C A T
Base content (bases) 7525 9030 4819 2706 4044 4986
Base content per 1 kb (bases) 455 545 291 163 244 301
Base content (%) 45.5% 54.5%
Total protein-coding genes (size: 11412 bases) GC AT G C A T
Base content (bases) 5271 6141 3544 1727 2865 3276
Base content per 1 kb (bases) 462 538 311 151 251 287
Base content (%) 46.2% 53.8%
D-loop (size: 848 bases) GC AT G C A T
Base content (bases) 300 548 187 113 268 280
Base content per 1 kb (bases) 354 646 221 133 316 330
Base content (%) 35.4% 64.6%
Total tRNA-coding genes (size: 1560 bases) GC AT G C A T
Base content (bases) 687 873 382 305 388 485
Base content per 1 kb (bases) 440 560 245 196 249 311
Base content (%) 44.0% 56.0%
Total rRNA-coding genes (size: 2658 bases) GC AT G C A T
Base content (bases) 1222 1436 679 543 512 924
Base content per 1 kb (bases) 460 540 255 204 193 348
Base content (%) 46.0% 54.0%
12S rRNA gene (size: 959 bases) GC AT G C A T
Base content (bases) 474 485 266 208 177 308
Base content per 1 kb (bases) 494 506 277 217 185 321
Base content (%) 49.4% 50.6%
16S rRNA gene (size: 1699 bases) GC AT G C A T
Base content (bases) 748 951 413 335 335 616
Base content per 1 kb (bases) 440 560 243 197 197 363
Base content (%) 44.0% 56.0%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 316 368 224 92 185 183
Base content per 1 kb (bases) 462 538 327 135 270 268
Base content (%) 46.2% 53.8%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 69 99 48 21 44 55
Base content per 1 kb (bases) 411 589 286 125 262 327
Base content (%) 41.1% 58.9%
COX1 (size: 1554 bases) GC AT G C A T
Base content (bases) 731 823 435 296 438 385
Base content per 1 kb (bases) 470 530 280 190 282 248
Base content (%) 47.0% 53.0%
COX2 (size: 691 bases) GC AT G C A T
Base content (bases) 307 384 185 122 174 210
Base content per 1 kb (bases) 444 556 268 177 252 304
Base content (%) 44.4% 55.6%
COX3 (size: 785 bases) GC AT G C A T
Base content (bases) 377 408 243 134 200 208
Base content per 1 kb (bases) 480 520 310 171 255 265
Base content (%) 48.0% 52.0%
CYTB (size: 1141 bases) GC AT G C A T
Base content (bases) 531 610 354 177 302 308
Base content per 1 kb (bases) 465 535 310 155 265 270
Base content (%) 46.5% 53.5%
ND1 (size: 975 bases) GC AT G C A T
Base content (bases) 447 528 308 139 252 276
Base content per 1 kb (bases) 458 542 316 143 258 283
Base content (%) 45.8% 54.2%
ND2 (size: 1045 bases) GC AT G C A T
Base content (bases) 459 586 335 124 241 345
Base content per 1 kb (bases) 439 561 321 119 231 330
Base content (%) 43.9% 56.1%
ND3 (size: 349 bases) GC AT G C A T
Base content (bases) 169 180 109 60 98 82
Base content per 1 kb (bases) 484 516 312 172 281 235
Base content (%) 48.4% 51.6%
ND4 (size: 1381 bases) GC AT G C A T
Base content (bases) 642 739 429 213 344 395
Base content per 1 kb (bases) 465 535 311 154 249 286
Base content (%) 46.5% 53.5%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 149 148 106 43 74 74
Base content per 1 kb (bases) 502 498 357 145 249 249
Base content (%) 50.2% 49.8%
ND5 (size: 1842 bases) GC AT G C A T
Base content (bases) 834 1008 590 244 455 553
Base content per 1 kb (bases) 453 547 320 132 247 300
Base content (%) 45.3% 54.7%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 245 277 181 64 64 213
Base content per 1 kb (bases) 469 531 347 123 123 408
Base content (%) 46.9% 53.1%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 10 (4.41%)
Alanine (Ala, A)
n = 20 (8.81%)
Serine (Ser, S)
n = 7 (3.08%)
Threonine (Thr, T)
n = 21 (9.25%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 15 (6.61%)
Leucine (Leu, L)
n = 56 (24.67%)
Isoleucine (Ile, I)
n = 18 (7.93%)
Methionine (Met, M)
n = 10 (4.41%)
Proline (Pro, P)
n = 17 (7.49%)
Phenylalanine (Phe, F)
n = 10 (4.41%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 10 (4.41%)
Glutamine (Gln, Q)
n = 9 (3.96%)
Histidine (His, H)
n = 4 (1.76%)
Lysine (Lys, K)
n = 1 (0.44%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 8 6 8 14 18 5 10 7 2 3 5 7 0 7 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 4 9 7 0 0 5 4 1 2 10 3 2 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 9 0 1 0 1 0 0 5 0 3 1 1 2 8 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 0 1 0 1 0 1 2 3 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
50 81 65 32
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 60 33 109
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 83 85 44
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPNPWFMILVFSWLIFLIVLPPKVLGHTFTNEPTHKNAEKIKPEPWTWPWY*
Amino acid frequencies:
Glycine (Gly, G)
n = 1 (1.82%)
Alanine (Ala, A)
n = 1 (1.82%)
Serine (Ser, S)
n = 1 (1.82%)
Threonine (Thr, T)
n = 4 (7.27%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 3 (5.45%)
Leucine (Leu, L)
n = 6 (10.91%)
Isoleucine (Ile, I)
n = 4 (7.27%)
Methionine (Met, M)
n = 2 (3.64%)
Proline (Pro, P)
n = 9 (16.36%)
Phenylalanine (Phe, F)
n = 4 (7.27%)
Tyrosine (Tyr, Y)
n = 1 (1.82%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 3 (5.45%)
Asparagine (Asn, N)
n = 4 (7.27%)
Glutamine (Gln, Q)
n = 1 (1.82%)
Histidine (His, H)
n = 2 (3.64%)
Lysine (Lys, K)
n = 4 (7.27%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 2 1 1 0 1 1 3 1 0 1 1 0 1 1 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 0 1 0 1 0 0 3 3 3 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 0 1 0 0 1 0 0 0 0 1 0 0 2 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 1 0 0 3 1 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
8 15 18 15
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 15 16 19
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 18 21 10
COX1 (size: 1554 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.09%)
Alanine (Ala, A)
n = 48 (9.28%)
Serine (Ser, S)
n = 29 (5.61%)
Threonine (Thr, T)
n = 36 (6.96%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 42 (8.12%)
Leucine (Leu, L)
n = 62 (11.99%)
Isoleucine (Ile, I)
n = 39 (7.54%)
Methionine (Met, M)
n = 25 (4.84%)
Proline (Pro, P)
n = 28 (5.42%)
Phenylalanine (Phe, F)
n = 41 (7.93%)
Tyrosine (Tyr, Y)
n = 19 (3.68%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.9%)
Glutamic acid (Glu, E)
n = 10 (1.93%)
Asparagine (Asn, N)
n = 15 (2.9%)
Glutamine (Gln, Q)
n = 8 (1.55%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 8 (1.55%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 19 13 11 7 22 10 11 5 3 5 8 18 11 18 23
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
12 0 1 12 23 12 1 9 18 14 6 4 13 7 4 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 17 2 4 9 12 0 0 4 11 8 3 1 4 11 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 7 3 6 9 8 0 3 2 2 1 0 0 1 0 14
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
162 113 127 116
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 137 95 209
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
57 185 163 113
COX2 (size: 691 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.93%)
Alanine (Ala, A)
n = 15 (6.55%)
Serine (Ser, S)
n = 18 (7.86%)
Threonine (Thr, T)
n = 10 (4.37%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 20 (8.73%)
Leucine (Leu, L)
n = 28 (12.23%)
Isoleucine (Ile, I)
n = 18 (7.86%)
Methionine (Met, M)
n = 12 (5.24%)
Proline (Pro, P)
n = 14 (6.11%)
Phenylalanine (Phe, F)
n = 8 (3.49%)
Tyrosine (Tyr, Y)
n = 10 (4.37%)
Tryptophan (Trp, W)
n = 5 (2.18%)
Aspartic acid (Asp, D)
n = 12 (5.24%)
Glutamic acid (Glu, E)
n = 16 (6.99%)
Asparagine (Asn, N)
n = 5 (2.18%)
Glutamine (Gln, Q)
n = 8 (3.49%)
Histidine (His, H)
n = 10 (4.37%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 6 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 5 7 3 6 10 5 4 7 1 3 3 10 4 3 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 2 2 5 6 2 0 2 7 0 1 5 8 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 4 3 2 8 5 0 1 2 4 6 1 0 1 4 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 14 2 4 8 2 2 0 1 5 0 0 0 0 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
72 62 52 44
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 54 65 86
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
25 69 93 43
COX3 (size: 785 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 23 (8.85%)
Serine (Ser, S)
n = 12 (4.62%)
Threonine (Thr, T)
n = 25 (9.62%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 19 (7.31%)
Leucine (Leu, L)
n = 32 (12.31%)
Isoleucine (Ile, I)
n = 12 (4.62%)
Methionine (Met, M)
n = 9 (3.46%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 22 (8.46%)
Tyrosine (Tyr, Y)
n = 12 (4.62%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 10 (3.85%)
Asparagine (Asn, N)
n = 2 (0.77%)
Glutamine (Gln, Q)
n = 9 (3.46%)
Histidine (His, H)
n = 15 (5.77%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 6 (2.31%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 4 6 7 6 14 3 2 8 1 3 8 7 1 11 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 2 3 9 10 1 2 7 9 2 1 6 4 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 10 0 1 5 3 0 0 3 4 8 0 0 0 2 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 8 2 1 4 2 0 0 2 4 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
77 72 53 59
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 69 55 94
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 102 99 46
CYTB (size: 1141 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (7.39%)
Alanine (Ala, A)
n = 27 (7.12%)
Serine (Ser, S)
n = 22 (5.8%)
Threonine (Thr, T)
n = 26 (6.86%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 26 (6.86%)
Leucine (Leu, L)
n = 58 (15.3%)
Isoleucine (Ile, I)
n = 27 (7.12%)
Methionine (Met, M)
n = 11 (2.9%)
Proline (Pro, P)
n = 21 (5.54%)
Phenylalanine (Phe, F)
n = 31 (8.18%)
Tyrosine (Tyr, Y)
n = 13 (3.43%)
Tryptophan (Trp, W)
n = 13 (3.43%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 4 (1.06%)
Asparagine (Asn, N)
n = 21 (5.54%)
Glutamine (Gln, Q)
n = 9 (2.37%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 17 10 9 17 17 5 8 8 1 0 8 9 9 14 17
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 3 2 17 8 0 1 11 11 5 2 8 10 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 14 2 4 10 7 0 0 1 4 9 0 2 5 16 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 4 0 2 9 9 0 0 0 6 2 0 0 0 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
96 98 95 91
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 95 79 153
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 161 134 57
ND1 (size: 975 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.56%)
Alanine (Ala, A)
n = 32 (9.88%)
Serine (Ser, S)
n = 18 (5.56%)
Threonine (Thr, T)
n = 21 (6.48%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 15 (4.63%)
Leucine (Leu, L)
n = 61 (18.83%)
Isoleucine (Ile, I)
n = 27 (8.33%)
Methionine (Met, M)
n = 14 (4.32%)
Proline (Pro, P)
n = 25 (7.72%)
Phenylalanine (Phe, F)
n = 17 (5.25%)
Tyrosine (Tyr, Y)
n = 14 (4.32%)
Tryptophan (Trp, W)
n = 8 (2.47%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.4%)
Asparagine (Asn, N)
n = 12 (3.7%)
Glutamine (Gln, Q)
n = 6 (1.85%)
Histidine (His, H)
n = 5 (1.54%)
Lysine (Lys, K)
n = 7 (2.16%)
Arginine (Arg, R)
n = 8 (2.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 16 11 3 13 29 6 8 6 0 2 4 9 0 5 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 0 4 15 13 0 1 11 2 4 5 6 12 2 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 8 0 4 6 5 1 1 1 3 11 0 2 6 6 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 8 3 0 4 7 0 0 1 7 0 0 0 0 1 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
80 95 83 67
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 94 60 134
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 119 133 51
ND2 (size: 1045 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.61%)
Alanine (Ala, A)
n = 34 (9.8%)
Serine (Ser, S)
n = 23 (6.63%)
Threonine (Thr, T)
n = 50 (14.41%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 9 (2.59%)
Leucine (Leu, L)
n = 63 (18.16%)
Isoleucine (Ile, I)
n = 28 (8.07%)
Methionine (Met, M)
n = 23 (6.63%)
Proline (Pro, P)
n = 18 (5.19%)
Phenylalanine (Phe, F)
n = 9 (2.59%)
Tyrosine (Tyr, Y)
n = 9 (2.59%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 6 (1.73%)
Asparagine (Asn, N)
n = 14 (4.03%)
Glutamine (Gln, Q)
n = 14 (4.03%)
Histidine (His, H)
n = 5 (1.44%)
Lysine (Lys, K)
n = 10 (2.88%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 17 18 6 14 30 5 7 11 3 1 3 4 1 5 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 0 2 20 12 0 3 5 7 1 3 9 6 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
24 21 2 3 5 8 0 3 4 5 4 1 1 6 8 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 6 0 1 0 10 0 0 0 4 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 96 132 54
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 118 59 132
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 121 154 54
ND3 (size: 1045 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.61%)
Alanine (Ala, A)
n = 34 (9.8%)
Serine (Ser, S)
n = 23 (6.63%)
Threonine (Thr, T)
n = 50 (14.41%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 9 (2.59%)
Leucine (Leu, L)
n = 63 (18.16%)
Isoleucine (Ile, I)
n = 28 (8.07%)
Methionine (Met, M)
n = 23 (6.63%)
Proline (Pro, P)
n = 18 (5.19%)
Phenylalanine (Phe, F)
n = 9 (2.59%)
Tyrosine (Tyr, Y)
n = 9 (2.59%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 6 (1.73%)
Asparagine (Asn, N)
n = 14 (4.03%)
Glutamine (Gln, Q)
n = 14 (4.03%)
Histidine (His, H)
n = 5 (1.44%)
Lysine (Lys, K)
n = 10 (2.88%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 17 18 6 14 30 5 7 11 3 1 3 4 1 5 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 0 2 20 12 0 3 5 7 1 3 9 6 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
24 21 2 3 5 8 0 3 4 5 4 1 1 6 8 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 6 0 1 0 10 0 0 0 4 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 96 132 54
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 118 59 132
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 121 154 54
ND4 (size: 1381 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (5.66%)
Alanine (Ala, A)
n = 42 (9.15%)
Serine (Ser, S)
n = 29 (6.32%)
Threonine (Thr, T)
n = 40 (8.71%)
Cysteine (Cys, C)
n = 6 (1.31%)
Valine (Val, V)
n = 14 (3.05%)
Leucine (Leu, L)
n = 87 (18.95%)
Isoleucine (Ile, I)
n = 44 (9.59%)
Methionine (Met, M)
n = 26 (5.66%)
Proline (Pro, P)
n = 27 (5.88%)
Phenylalanine (Phe, F)
n = 15 (3.27%)
Tyrosine (Tyr, Y)
n = 14 (3.05%)
Tryptophan (Trp, W)
n = 19 (4.14%)
Aspartic acid (Asp, D)
n = 3 (0.65%)
Glutamic acid (Glu, E)
n = 13 (2.83%)
Asparagine (Asn, N)
n = 13 (2.83%)
Glutamine (Gln, Q)
n = 12 (2.61%)
Histidine (His, H)
n = 9 (1.96%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 22 15 10 16 40 7 10 10 2 3 4 6 1 5 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
11 2 4 3 22 15 2 2 10 7 7 3 10 14 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 12 4 3 10 8 1 0 7 4 10 2 4 3 10 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 10 3 1 2 8 2 0 2 9 0 0 0 0 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
98 132 140 90
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
69 131 74 186
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
46 166 181 67
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 6 (6.12%)
Alanine (Ala, A)
n = 11 (11.22%)
Serine (Ser, S)
n = 9 (9.18%)
Threonine (Thr, T)
n = 10 (10.2%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 2 (2.04%)
Leucine (Leu, L)
n = 24 (24.49%)
Isoleucine (Ile, I)
n = 1 (1.02%)
Methionine (Met, M)
n = 6 (6.12%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 6 (6.12%)
Tyrosine (Tyr, Y)
n = 1 (1.02%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 3 (3.06%)
Histidine (His, H)
n = 5 (5.1%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 0 3 3 8 8 1 4 3 0 0 0 2 0 1 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 2 1 7 2 1 1 1 3 1 1 0 1 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 3 0 2 4 1 0 0 2 1 0 0 0 0 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 3 0 0 1 0 0 0 0 2 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
23 32 21 23
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
14 30 16 39
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 44 37 12
ND5 (size: 1842 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 31 (5.06%)
Alanine (Ala, A)
n = 49 (7.99%)
Serine (Ser, S)
n = 45 (7.34%)
Threonine (Thr, T)
n = 64 (10.44%)
Cysteine (Cys, C)
n = 6 (0.98%)
Valine (Val, V)
n = 22 (3.59%)
Leucine (Leu, L)
n = 95 (15.5%)
Isoleucine (Ile, I)
n = 53 (8.65%)
Methionine (Met, M)
n = 30 (4.89%)
Proline (Pro, P)
n = 30 (4.89%)
Phenylalanine (Phe, F)
n = 42 (6.85%)
Tyrosine (Tyr, Y)
n = 10 (1.63%)
Tryptophan (Trp, W)
n = 14 (2.28%)
Aspartic acid (Asp, D)
n = 12 (1.96%)
Glutamic acid (Glu, E)
n = 11 (1.79%)
Asparagine (Asn, N)
n = 30 (4.89%)
Glutamine (Gln, Q)
n = 22 (3.59%)
Histidine (His, H)
n = 16 (2.61%)
Lysine (Lys, K)
n = 22 (3.59%)
Arginine (Arg, R)
n = 9 (1.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
26 27 19 9 27 33 11 14 21 1 3 7 8 4 13 29
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
11 3 3 3 32 11 3 1 12 15 3 2 16 8 4 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
28 23 3 5 13 13 0 3 11 5 5 0 1 3 27 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 9 2 4 8 21 1 1 1 6 1 0 0 1 0 14
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
125 157 213 119
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
74 174 124 242
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
45 259 216 94
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (13.87%)
Alanine (Ala, A)
n = 16 (9.25%)
Serine (Ser, S)
n = 12 (6.94%)
Threonine (Thr, T)
n = 4 (2.31%)
Cysteine (Cys, C)
n = 2 (1.16%)
Valine (Val, V)
n = 29 (16.76%)
Leucine (Leu, L)
n = 31 (17.92%)
Isoleucine (Ile, I)
n = 5 (2.89%)
Methionine (Met, M)
n = 4 (2.31%)
Proline (Pro, P)
n = 4 (2.31%)
Phenylalanine (Phe, F)
n = 12 (6.94%)
Tyrosine (Tyr, Y)
n = 9 (5.2%)
Tryptophan (Trp, W)
n = 5 (2.89%)
Aspartic acid (Asp, D)
n = 5 (2.89%)
Glutamic acid (Glu, E)
n = 4 (2.31%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 1 (0.58%)
Lysine (Lys, K)
n = 1 (0.58%)
Arginine (Arg, R)
n = 4 (2.31%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 1 0 4 1 1 4 7 0 0 11 0 5 13 11 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 2 0 9 1 4 2 4 1 3 16 4 0 0 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 1 0 4 2 2 2 2 0 6 3 4 14 0 1 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 3 5 0 0 1 2 0 0 2 0 0 0 1 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
78 19 17 60
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 34 22 81
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
66 11 25 72
Total protein-coding genes (size: 11434 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 242 (6.36%)
Alanine (Ala, A)
n = 329 (8.64%)
Serine (Ser, S)
n = 231 (6.07%)
Threonine (Thr, T)
n = 318 (8.35%)
Cysteine (Cys, C)
n = 30 (0.79%)
Valine (Val, V)
n = 222 (5.83%)
Leucine (Leu, L)
n = 630 (16.54%)
Isoleucine (Ile, I)
n = 284 (7.46%)
Methionine (Met, M)
n = 175 (4.6%)
Proline (Pro, P)
n = 215 (5.65%)
Phenylalanine (Phe, F)
n = 224 (5.88%)
Tyrosine (Tyr, Y)
n = 117 (3.07%)
Tryptophan (Trp, W)
n = 120 (3.15%)
Aspartic acid (Asp, D)
n = 74 (1.94%)
Glutamic acid (Glu, E)
n = 101 (2.65%)
Asparagine (Asn, N)
n = 130 (3.41%)
Glutamine (Gln, Q)
n = 104 (2.73%)
Histidine (His, H)
n = 103 (2.7%)
Lysine (Lys, K)
n = 79 (2.07%)
Arginine (Arg, R)
n = 74 (1.94%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
141 143 111 77 133 233 66 94 90 14 38 53 85 46 98 126
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
64 10 20 45 164 107 13 24 86 84 48 31 93 77 14 36
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
141 124 17 34 76 67 4 10 40 49 68 15 27 32 98 22
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
81 82 19 25 49 72 7 7 11 50 6 0 0 5 2 105
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
968 1005 1036 800
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
516 1043 715 1535
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
362 1382 1386 679

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.