Viewing data for Bungarus fasciatus


Scientific name Bungarus fasciatus
Common name Red-headed krait
Maximum lifespan 13.20 years (Bungarus fasciatus@AnAge)

Total mtDNA (size: 17234 bases) GC AT G C A T
Base content (bases) 6272 10962 4253 2019 5057 5905
Base content per 1 kb (bases) 364 636 247 117 293 343
Base content (%) 36.4% 63.6%
Total protein-coding genes (size: 11238 bases) GC AT G C A T
Base content (bases) 3954 7284 2790 1164 3373 3911
Base content per 1 kb (bases) 352 648 248 104 300 348
Base content (%) 35.2% 64.8%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1434 bases) GC AT G C A T
Base content (bases) 568 866 340 228 383 483
Base content per 1 kb (bases) 396 604 237 159 267 337
Base content (%) 39.6% 60.4%
Total rRNA-coding genes (size: 2402 bases) GC AT G C A T
Base content (bases) 940 1462 551 389 548 914
Base content per 1 kb (bases) 391 609 229 162 228 381
Base content (%) 39.1% 60.9%
12S rRNA gene (size: 932 bases) GC AT G C A T
Base content (bases) 382 550 223 159 199 351
Base content per 1 kb (bases) 410 590 239 171 214 377
Base content (%) 41.0% 59.0%
16S rRNA gene (size: 1470 bases) GC AT G C A T
Base content (bases) 558 912 328 230 349 563
Base content per 1 kb (bases) 380 620 223 156 237 383
Base content (%) 38.0% 62.0%

ATP6 (size: 680 bases) GC AT G C A T
Base content (bases) 232 448 167 65 213 235
Base content per 1 kb (bases) 341 659 246 96 313 346
Base content (%) 34.1% 65.9%
ATP8 (size: 165 bases) GC AT G C A T
Base content (bases) 46 119 39 7 43 76
Base content per 1 kb (bases) 279 721 236 42 261 461
Base content (%) 27.9% 72.1%
COX1 (size: 1602 bases) GC AT G C A T
Base content (bases) 610 992 375 235 522 470
Base content per 1 kb (bases) 381 619 234 147 326 293
Base content (%) 38.1% 61.9%
COX2 (size: 685 bases) GC AT G C A T
Base content (bases) 271 414 167 104 185 229
Base content per 1 kb (bases) 396 604 244 152 270 334
Base content (%) 39.6% 60.4%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 300 484 192 108 242 242
Base content per 1 kb (bases) 383 617 245 138 309 309
Base content (%) 38.3% 61.7%
CYTB (size: 1111 bases) GC AT G C A T
Base content (bases) 394 717 286 108 367 350
Base content per 1 kb (bases) 355 645 257 97 330 315
Base content (%) 35.5% 64.5%
ND1 (size: 964 bases) GC AT G C A T
Base content (bases) 354 610 260 94 271 339
Base content per 1 kb (bases) 367 633 270 98 281 352
Base content (%) 36.7% 63.3%
ND2 (size: 1030 bases) GC AT G C A T
Base content (bases) 348 682 268 80 279 403
Base content per 1 kb (bases) 338 662 260 78 271 391
Base content (%) 33.8% 66.2%
ND3 (size: 343 bases) GC AT G C A T
Base content (bases) 111 232 76 35 112 120
Base content per 1 kb (bases) 324 676 222 102 327 350
Base content (%) 32.4% 67.6%
ND4 (size: 1337 bases) GC AT G C A T
Base content (bases) 474 863 354 120 404 459
Base content per 1 kb (bases) 355 645 265 90 302 343
Base content (%) 35.5% 64.5%
ND4L (size: 290 bases) GC AT G C A T
Base content (bases) 94 196 65 29 93 103
Base content per 1 kb (bases) 324 676 224 100 321 355
Base content (%) 32.4% 67.6%
ND5 (size: 1767 bases) GC AT G C A T
Base content (bases) 566 1201 415 151 550 651
Base content per 1 kb (bases) 320 680 235 85 311 368
Base content (%) 32.0% 68.0%
ND6 (size: 495 bases) GC AT G C A T
Base content (bases) 157 338 128 29 96 242
Base content per 1 kb (bases) 317 683 259 59 194 489
Base content (%) 31.7% 68.3%

ATP6 (size: 680 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 7 (3.11%)
Alanine (Ala, A)
n = 14 (6.22%)
Serine (Ser, S)
n = 11 (4.89%)
Threonine (Thr, T)
n = 28 (12.44%)
Cysteine (Cys, C)
n = 2 (0.89%)
Valine (Val, V)
n = 6 (2.67%)
Leucine (Leu, L)
n = 49 (21.78%)
Isoleucine (Ile, I)
n = 22 (9.78%)
Methionine (Met, M)
n = 19 (8.44%)
Proline (Pro, P)
n = 12 (5.33%)
Phenylalanine (Phe, F)
n = 8 (3.56%)
Tyrosine (Tyr, Y)
n = 5 (2.22%)
Tryptophan (Trp, W)
n = 2 (0.89%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 6 (2.67%)
Asparagine (Asn, N)
n = 11 (4.89%)
Glutamine (Gln, Q)
n = 7 (3.11%)
Histidine (His, H)
n = 6 (2.67%)
Lysine (Lys, K)
n = 6 (2.67%)
Arginine (Arg, R)
n = 4 (1.78%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 5 18 13 3 22 2 9 5 2 4 0 2 0 4 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 2 0 4 5 5 0 1 3 3 0 2 0 8 2 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 12 0 1 0 5 0 2 3 5 0 1 0 6 5 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 5 1 1 0 5 1 0 2 1 1 0 0 0 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
34 69 91 32
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
20 60 42 104
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 38 101 76
ATP8 (size: 165 bases)
Amino acid sequence: MPQLSTTYIFLIYLWIWLMLYLTMQKINMMLMNKTPTNMSHTKPNKLSPTLPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 3 (5.56%)
Threonine (Thr, T)
n = 8 (14.81%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 9 (16.67%)
Isoleucine (Ile, I)
n = 4 (7.41%)
Methionine (Met, M)
n = 7 (12.96%)
Proline (Pro, P)
n = 5 (9.26%)
Phenylalanine (Phe, F)
n = 1 (1.85%)
Tyrosine (Tyr, Y)
n = 3 (5.56%)
Tryptophan (Trp, W)
n = 3 (5.56%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 4 (7.41%)
Glutamine (Gln, Q)
n = 2 (3.7%)
Histidine (His, H)
n = 1 (1.85%)
Lysine (Lys, K)
n = 4 (7.41%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 2 6 0 1 3 1 3 2 0 0 0 0 0 0 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 0 0 0 0 0 0 0 0 5 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 4 0 0 0 2 0 1 0 0 3 0 1 4 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 0 0 0 0 4 0 0 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
0 13 28 14
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
4 15 15 21
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 11 33 8
COX1 (size: 1602 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 45 (8.44%)
Alanine (Ala, A)
n = 36 (6.75%)
Serine (Ser, S)
n = 36 (6.75%)
Threonine (Thr, T)
n = 41 (7.69%)
Cysteine (Cys, C)
n = 3 (0.56%)
Valine (Val, V)
n = 29 (5.44%)
Leucine (Leu, L)
n = 62 (11.63%)
Isoleucine (Ile, I)
n = 48 (9.01%)
Methionine (Met, M)
n = 31 (5.82%)
Proline (Pro, P)
n = 31 (5.82%)
Phenylalanine (Phe, F)
n = 44 (8.26%)
Tyrosine (Tyr, Y)
n = 19 (3.56%)
Tryptophan (Trp, W)
n = 19 (3.56%)
Aspartic acid (Asp, D)
n = 13 (2.44%)
Glutamic acid (Glu, E)
n = 10 (1.88%)
Asparagine (Asn, N)
n = 18 (3.38%)
Glutamine (Gln, Q)
n = 9 (1.69%)
Histidine (His, H)
n = 18 (3.38%)
Lysine (Lys, K)
n = 12 (2.25%)
Arginine (Arg, R)
n = 9 (1.69%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
30 18 28 11 3 29 1 17 9 0 9 7 10 3 26 18
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 2 10 14 12 0 8 14 18 5 7 3 20 1 14
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 13 0 8 6 15 1 4 2 13 6 1 1 8 10 13
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 9 1 9 4 11 1 4 0 4 1 1 0 0 0 18
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
133 111 157 133
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
83 138 99 214
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 126 214 175
COX2 (size: 685 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.85%)
Alanine (Ala, A)
n = 17 (7.49%)
Serine (Ser, S)
n = 15 (6.61%)
Threonine (Thr, T)
n = 19 (8.37%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 20 (8.81%)
Leucine (Leu, L)
n = 28 (12.33%)
Isoleucine (Ile, I)
n = 15 (6.61%)
Methionine (Met, M)
n = 12 (5.29%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 8 (3.52%)
Tyrosine (Tyr, Y)
n = 7 (3.08%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 9 (3.96%)
Glutamic acid (Glu, E)
n = 14 (6.17%)
Asparagine (Asn, N)
n = 5 (2.2%)
Glutamine (Gln, Q)
n = 12 (5.29%)
Histidine (His, H)
n = 6 (2.64%)
Lysine (Lys, K)
n = 2 (0.88%)
Arginine (Arg, R)
n = 7 (3.08%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 8 10 7 2 13 0 6 11 1 3 3 14 0 4 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 1 5 0 11 1 0 6 5 0 3 2 8 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 7 0 0 4 8 1 1 1 5 2 0 0 3 2 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 14 0 5 4 2 0 1 1 5 0 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 60 55 42
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
28 62 55 83
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 45 119 59
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.31%)
Alanine (Ala, A)
n = 13 (5.0%)
Serine (Ser, S)
n = 17 (6.54%)
Threonine (Thr, T)
n = 28 (10.77%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 16 (6.15%)
Leucine (Leu, L)
n = 37 (14.23%)
Isoleucine (Ile, I)
n = 16 (6.15%)
Methionine (Met, M)
n = 10 (3.85%)
Proline (Pro, P)
n = 11 (4.23%)
Phenylalanine (Phe, F)
n = 18 (6.92%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 10 (3.85%)
Asparagine (Asn, N)
n = 6 (2.31%)
Glutamine (Gln, Q)
n = 6 (2.31%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 6 (2.31%)
Arginine (Arg, R)
n = 4 (1.54%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 6 9 7 3 17 0 9 6 0 4 3 8 1 11 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 4 4 5 0 6 5 8 0 3 1 7 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 9 0 3 3 7 0 1 3 7 4 0 1 3 3 10
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 8 2 1 3 5 1 1 0 3 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
62 64 70 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
40 65 59 97
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 63 113 79
CYTB (size: 1111 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (5.15%)
Alanine (Ala, A)
n = 19 (5.15%)
Serine (Ser, S)
n = 30 (8.13%)
Threonine (Thr, T)
n = 29 (7.86%)
Cysteine (Cys, C)
n = 2 (0.54%)
Valine (Val, V)
n = 9 (2.44%)
Leucine (Leu, L)
n = 51 (13.82%)
Isoleucine (Ile, I)
n = 49 (13.28%)
Methionine (Met, M)
n = 20 (5.42%)
Proline (Pro, P)
n = 21 (5.69%)
Phenylalanine (Phe, F)
n = 28 (7.59%)
Tyrosine (Tyr, Y)
n = 14 (3.79%)
Tryptophan (Trp, W)
n = 12 (3.25%)
Aspartic acid (Asp, D)
n = 6 (1.63%)
Glutamic acid (Glu, E)
n = 6 (1.63%)
Asparagine (Asn, N)
n = 22 (5.96%)
Glutamine (Gln, Q)
n = 7 (1.9%)
Histidine (His, H)
n = 13 (3.52%)
Lysine (Lys, K)
n = 8 (2.17%)
Arginine (Arg, R)
n = 5 (1.36%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
26 23 18 14 3 18 2 14 7 0 1 2 6 0 8 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 1 7 4 8 0 3 6 10 0 5 2 14 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 13 0 7 8 11 2 0 2 5 9 1 0 11 11 12
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 5 1 5 1 7 1 1 2 2 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
59 83 130 98
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
40 97 76 157
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 106 144 111
ND1 (size: 964 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (5.0%)
Alanine (Ala, A)
n = 18 (5.63%)
Serine (Ser, S)
n = 27 (8.44%)
Threonine (Thr, T)
n = 30 (9.38%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 7 (2.19%)
Leucine (Leu, L)
n = 59 (18.44%)
Isoleucine (Ile, I)
n = 23 (7.19%)
Methionine (Met, M)
n = 28 (8.75%)
Proline (Pro, P)
n = 23 (7.19%)
Phenylalanine (Phe, F)
n = 17 (5.31%)
Tyrosine (Tyr, Y)
n = 10 (3.13%)
Tryptophan (Trp, W)
n = 8 (2.5%)
Aspartic acid (Asp, D)
n = 3 (0.94%)
Glutamic acid (Glu, E)
n = 11 (3.44%)
Asparagine (Asn, N)
n = 14 (4.38%)
Glutamine (Gln, Q)
n = 9 (2.81%)
Histidine (His, H)
n = 2 (0.63%)
Lysine (Lys, K)
n = 8 (2.5%)
Arginine (Arg, R)
n = 7 (2.19%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 14 26 6 5 36 0 12 9 0 3 1 3 0 8 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 0 3 4 11 0 1 2 11 2 2 5 16 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 11 1 4 10 12 0 1 0 4 6 1 0 9 5 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 11 0 2 1 8 0 1 1 5 0 0 0 0 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
55 88 104 74
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 97 57 134
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 75 178 62
ND2 (size: 1030 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (2.63%)
Alanine (Ala, A)
n = 20 (5.85%)
Serine (Ser, S)
n = 25 (7.31%)
Threonine (Thr, T)
n = 61 (17.84%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 8 (2.34%)
Leucine (Leu, L)
n = 51 (14.91%)
Isoleucine (Ile, I)
n = 34 (9.94%)
Methionine (Met, M)
n = 38 (11.11%)
Proline (Pro, P)
n = 19 (5.56%)
Phenylalanine (Phe, F)
n = 7 (2.05%)
Tyrosine (Tyr, Y)
n = 8 (2.34%)
Tryptophan (Trp, W)
n = 10 (2.92%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.46%)
Asparagine (Asn, N)
n = 13 (3.8%)
Glutamine (Gln, Q)
n = 6 (1.75%)
Histidine (His, H)
n = 10 (2.92%)
Lysine (Lys, K)
n = 13 (3.8%)
Arginine (Arg, R)
n = 4 (1.17%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 14 37 7 4 21 4 15 6 0 2 2 3 1 2 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 8 2 10 0 0 4 4 1 4 0 15 0 12
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 33 0 6 5 10 0 1 3 4 4 0 0 7 6 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 4 1 1 0 12 1 0 0 4 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
43 75 163 62
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
28 121 56 138
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 72 184 78
ND3 (size: 1030 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (2.63%)
Alanine (Ala, A)
n = 20 (5.85%)
Serine (Ser, S)
n = 25 (7.31%)
Threonine (Thr, T)
n = 61 (17.84%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 8 (2.34%)
Leucine (Leu, L)
n = 51 (14.91%)
Isoleucine (Ile, I)
n = 34 (9.94%)
Methionine (Met, M)
n = 38 (11.11%)
Proline (Pro, P)
n = 19 (5.56%)
Phenylalanine (Phe, F)
n = 7 (2.05%)
Tyrosine (Tyr, Y)
n = 8 (2.34%)
Tryptophan (Trp, W)
n = 10 (2.92%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.46%)
Asparagine (Asn, N)
n = 13 (3.8%)
Glutamine (Gln, Q)
n = 6 (1.75%)
Histidine (His, H)
n = 10 (2.92%)
Lysine (Lys, K)
n = 13 (3.8%)
Arginine (Arg, R)
n = 4 (1.17%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 14 37 7 4 21 4 15 6 0 2 2 3 1 2 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 8 2 10 0 0 4 4 1 4 0 15 0 12
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 33 0 6 5 10 0 1 3 4 4 0 0 7 6 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 4 1 1 0 12 1 0 0 4 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
43 75 163 62
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
28 121 56 138
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 72 184 78
ND4 (size: 1337 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (3.38%)
Alanine (Ala, A)
n = 28 (6.31%)
Serine (Ser, S)
n = 33 (7.43%)
Threonine (Thr, T)
n = 52 (11.71%)
Cysteine (Cys, C)
n = 4 (0.9%)
Valine (Val, V)
n = 5 (1.13%)
Leucine (Leu, L)
n = 86 (19.37%)
Isoleucine (Ile, I)
n = 44 (9.91%)
Methionine (Met, M)
n = 36 (8.11%)
Proline (Pro, P)
n = 25 (5.63%)
Phenylalanine (Phe, F)
n = 19 (4.28%)
Tyrosine (Tyr, Y)
n = 13 (2.93%)
Tryptophan (Trp, W)
n = 10 (2.25%)
Aspartic acid (Asp, D)
n = 3 (0.68%)
Glutamic acid (Glu, E)
n = 9 (2.03%)
Asparagine (Asn, N)
n = 16 (3.6%)
Glutamine (Gln, Q)
n = 18 (4.05%)
Histidine (His, H)
n = 9 (2.03%)
Lysine (Lys, K)
n = 11 (2.48%)
Arginine (Arg, R)
n = 9 (2.03%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 22 33 13 9 39 1 24 16 2 0 1 3 1 7 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 2 12 7 9 0 5 1 6 3 7 3 14 1 13
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 24 3 9 6 12 0 2 4 5 8 2 0 14 2 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 9 0 1 2 11 0 1 2 6 0 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
60 123 165 97
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 132 79 190
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 99 214 116
ND4L (size: 290 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 3 (3.16%)
Alanine (Ala, A)
n = 4 (4.21%)
Serine (Ser, S)
n = 7 (7.37%)
Threonine (Thr, T)
n = 12 (12.63%)
Cysteine (Cys, C)
n = 2 (2.11%)
Valine (Val, V)
n = 8 (8.42%)
Leucine (Leu, L)
n = 18 (18.95%)
Isoleucine (Ile, I)
n = 9 (9.47%)
Methionine (Met, M)
n = 11 (11.58%)
Proline (Pro, P)
n = 2 (2.11%)
Phenylalanine (Phe, F)
n = 4 (4.21%)
Tyrosine (Tyr, Y)
n = 1 (1.05%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.05%)
Glutamic acid (Glu, E)
n = 2 (2.11%)
Asparagine (Asn, N)
n = 4 (4.21%)
Glutamine (Gln, Q)
n = 2 (2.11%)
Histidine (His, H)
n = 2 (2.11%)
Lysine (Lys, K)
n = 3 (3.16%)
Arginine (Arg, R)
n = 1 (1.05%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 2 9 6 2 6 1 3 2 0 4 0 4 0 3 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 1 0 1 3 0 0 0 3 0 1 1 0 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 8 0 1 2 2 0 0 2 1 0 0 0 0 4 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 0 0 1 3 0 0 0 1 0 0 0 0 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
18 22 41 15
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
8 23 15 50
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 20 46 27
ND5 (size: 1767 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 23 (3.91%)
Alanine (Ala, A)
n = 37 (6.29%)
Serine (Ser, S)
n = 45 (7.65%)
Threonine (Thr, T)
n = 65 (11.05%)
Cysteine (Cys, C)
n = 3 (0.51%)
Valine (Val, V)
n = 10 (1.7%)
Leucine (Leu, L)
n = 90 (15.31%)
Isoleucine (Ile, I)
n = 70 (11.9%)
Methionine (Met, M)
n = 48 (8.16%)
Proline (Pro, P)
n = 25 (4.25%)
Phenylalanine (Phe, F)
n = 30 (5.1%)
Tyrosine (Tyr, Y)
n = 11 (1.87%)
Tryptophan (Trp, W)
n = 10 (1.7%)
Aspartic acid (Asp, D)
n = 8 (1.36%)
Glutamic acid (Glu, E)
n = 11 (1.87%)
Asparagine (Asn, N)
n = 38 (6.46%)
Glutamine (Gln, Q)
n = 16 (2.72%)
Histidine (His, H)
n = 13 (2.21%)
Lysine (Lys, K)
n = 26 (4.42%)
Arginine (Arg, R)
n = 9 (1.53%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
44 26 46 14 10 37 0 29 14 2 5 1 4 0 15 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 1 10 14 13 0 6 4 13 0 7 2 16 0 20
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 31 1 12 6 17 2 6 2 6 5 0 0 24 14 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 10 1 4 4 25 1 0 3 6 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
89 124 255 121
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 164 124 248
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 127 272 181
ND6 (size: 495 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 22 (13.41%)
Alanine (Ala, A)
n = 6 (3.66%)
Serine (Ser, S)
n = 13 (7.93%)
Threonine (Thr, T)
n = 2 (1.22%)
Cysteine (Cys, C)
n = 6 (3.66%)
Valine (Val, V)
n = 25 (15.24%)
Leucine (Leu, L)
n = 26 (15.85%)
Isoleucine (Ile, I)
n = 10 (6.1%)
Methionine (Met, M)
n = 6 (3.66%)
Proline (Pro, P)
n = 1 (0.61%)
Phenylalanine (Phe, F)
n = 18 (10.98%)
Tyrosine (Tyr, Y)
n = 9 (5.49%)
Tryptophan (Trp, W)
n = 3 (1.83%)
Aspartic acid (Asp, D)
n = 2 (1.22%)
Glutamic acid (Glu, E)
n = 3 (1.83%)
Asparagine (Asn, N)
n = 5 (3.05%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 1 (0.61%)
Lysine (Lys, K)
n = 3 (1.83%)
Arginine (Arg, R)
n = 3 (1.83%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 2 2 2 0 0 0 14 0 0 12 1 8 4 18 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 6 0 4 1 1 0 11 1 5 5 0 1 0 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 2 0 5 0 0 0 8 0 9 0 0 10 5 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 1 2 1 1 1 2 3 0 0 0 1 0 0 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
58 7 35 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 14 23 85
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
27 8 38 92
Total protein-coding genes (size: 11253 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 194 (5.18%)
Alanine (Ala, A)
n = 217 (5.79%)
Serine (Ser, S)
n = 269 (7.18%)
Threonine (Thr, T)
n = 389 (10.38%)
Cysteine (Cys, C)
n = 29 (0.77%)
Valine (Val, V)
n = 144 (3.84%)
Leucine (Leu, L)
n = 587 (15.67%)
Isoleucine (Ile, I)
n = 357 (9.53%)
Methionine (Met, M)
n = 274 (7.31%)
Proline (Pro, P)
n = 195 (5.21%)
Phenylalanine (Phe, F)
n = 209 (5.58%)
Tyrosine (Tyr, Y)
n = 114 (3.04%)
Tryptophan (Trp, W)
n = 97 (2.59%)
Aspartic acid (Asp, D)
n = 54 (1.44%)
Glutamic acid (Glu, E)
n = 93 (2.48%)
Asparagine (Asn, N)
n = 162 (4.32%)
Glutamine (Gln, Q)
n = 95 (2.54%)
Histidine (His, H)
n = 97 (2.59%)
Lysine (Lys, K)
n = 104 (2.78%)
Arginine (Arg, R)
n = 63 (1.68%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
211 146 250 103 48 250 12 161 88 7 48 21 65 10 110 99
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
24 18 11 69 57 90 1 41 47 90 16 41 20 129 5 105
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
104 175 5 60 50 103 6 27 23 67 47 6 13 98 64 58
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
39 81 12 31 23 96 8 12 11 38 2 2 0 2 0 91
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
702 863 1338 844
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
435 1020 721 1571
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
127 810 1711 1099

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.