Viewing data for Ardea cinerea


Scientific name Ardea cinerea
Common name Heron
Maximum lifespan 37.50 years (Ardea cinerea@AnAge)

Total mtDNA (size: 18703 bases) GC AT G C A T
Base content (bases) 8455 10248 5765 2690 4528 5720
Base content per 1 kb (bases) 452 548 308 144 242 306
Base content (%) 45.2% 54.8%
Total protein-coding genes (size: 11379 bases) GC AT G C A T
Base content (bases) 5307 6072 3869 1438 2688 3384
Base content per 1 kb (bases) 466 534 340 126 236 297
Base content (%) 46.6% 53.4%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1621 bases) GC AT G C A T
Base content (bases) 678 943 405 273 409 534
Base content per 1 kb (bases) 418 582 250 168 252 329
Base content (%) 41.8% 58.2%
Total rRNA-coding genes (size: 2571 bases) GC AT G C A T
Base content (bases) 1186 1385 687 499 547 838
Base content per 1 kb (bases) 461 539 267 194 213 326
Base content (%) 46.1% 53.9%
12S rRNA gene (size: 972 bases) GC AT G C A T
Base content (bases) 463 509 267 196 197 312
Base content per 1 kb (bases) 476 524 275 202 203 321
Base content (%) 47.6% 52.4%
16S rRNA gene (size: 1599 bases) GC AT G C A T
Base content (bases) 723 876 420 303 350 526
Base content per 1 kb (bases) 452 548 263 189 219 329
Base content (%) 45.2% 54.8%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 326 358 255 71 153 205
Base content per 1 kb (bases) 477 523 373 104 224 300
Base content (%) 47.7% 52.3%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 77 91 65 12 38 53
Base content per 1 kb (bases) 458 542 387 71 226 315
Base content (%) 45.8% 54.2%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 715 836 460 255 403 433
Base content per 1 kb (bases) 461 539 297 164 260 279
Base content (%) 46.1% 53.9%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 310 374 215 95 159 215
Base content per 1 kb (bases) 453 547 314 139 232 314
Base content (%) 45.3% 54.7%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 372 412 254 118 188 224
Base content per 1 kb (bases) 474 526 324 151 240 286
Base content (%) 47.4% 52.6%
CYTB (size: 1143 bases) GC AT G C A T
Base content (bases) 566 577 418 148 270 307
Base content per 1 kb (bases) 495 505 366 129 236 269
Base content (%) 49.5% 50.5%
ND1 (size: 978 bases) GC AT G C A T
Base content (bases) 463 515 326 137 262 253
Base content per 1 kb (bases) 473 527 333 140 268 259
Base content (%) 47.3% 52.7%
ND2 (size: 1041 bases) GC AT G C A T
Base content (bases) 470 571 355 115 244 327
Base content per 1 kb (bases) 451 549 341 110 234 314
Base content (%) 45.1% 54.9%
ND3 (size: 352 bases) GC AT G C A T
Base content (bases) 160 192 117 43 98 94
Base content per 1 kb (bases) 455 545 332 122 278 267
Base content (%) 45.5% 54.5%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 636 742 488 148 332 410
Base content per 1 kb (bases) 462 538 354 107 241 298
Base content (%) 46.2% 53.8%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 141 156 105 36 68 88
Base content per 1 kb (bases) 475 525 354 121 229 296
Base content (%) 47.5% 52.5%
ND5 (size: 1815 bases) GC AT G C A T
Base content (bases) 843 972 632 211 408 564
Base content per 1 kb (bases) 464 536 348 116 225 311
Base content (%) 46.4% 53.6%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 233 289 182 51 69 220
Base content per 1 kb (bases) 446 554 349 98 132 421
Base content (%) 44.6% 55.4%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 17 (7.49%)
Serine (Ser, S)
n = 10 (4.41%)
Threonine (Thr, T)
n = 28 (12.33%)
Cysteine (Cys, C)
n = 1 (0.44%)
Valine (Val, V)
n = 7 (3.08%)
Leucine (Leu, L)
n = 64 (28.19%)
Isoleucine (Ile, I)
n = 17 (7.49%)
Methionine (Met, M)
n = 10 (4.41%)
Proline (Pro, P)
n = 16 (7.05%)
Phenylalanine (Phe, F)
n = 7 (3.08%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 10 (4.41%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 4 (1.76%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 14 6 7 19 29 3 5 7 1 1 4 2 0 1 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 2 8 7 0 1 4 3 0 1 5 8 2 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 17 0 0 4 2 0 0 4 1 2 0 1 1 9 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 4 0 0 1 2 1 0 3 2 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
37 91 72 28
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
22 67 34 105
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 97 99 20
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPNPWFLTLLMSWATFSLIIQPKLLAFTTTNPPSTKSKVSPKTTPWAWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 3 (5.45%)
Serine (Ser, S)
n = 5 (9.09%)
Threonine (Thr, T)
n = 9 (16.36%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.82%)
Leucine (Leu, L)
n = 7 (12.73%)
Isoleucine (Ile, I)
n = 2 (3.64%)
Methionine (Met, M)
n = 2 (3.64%)
Proline (Pro, P)
n = 9 (16.36%)
Phenylalanine (Phe, F)
n = 3 (5.45%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 3 (5.45%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 4 (7.27%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 2 1 1 3 2 0 1 2 0 0 0 1 0 0 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 1 2 0 0 0 0 0 2 3 4 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 0 0 2 1 1 1 0 0 0 0 0 0 1 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 0 0 3 1 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
4 17 20 15
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 26 10 15
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 22 23 8
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.11%)
Alanine (Ala, A)
n = 46 (8.91%)
Serine (Ser, S)
n = 26 (5.04%)
Threonine (Thr, T)
n = 41 (7.95%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 34 (6.59%)
Leucine (Leu, L)
n = 61 (11.82%)
Isoleucine (Ile, I)
n = 41 (7.95%)
Methionine (Met, M)
n = 27 (5.23%)
Proline (Pro, P)
n = 32 (6.2%)
Phenylalanine (Phe, F)
n = 41 (7.95%)
Tyrosine (Tyr, Y)
n = 18 (3.49%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 14 (2.71%)
Glutamine (Gln, Q)
n = 9 (1.74%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 29 25 5 12 33 4 7 6 3 5 10 17 2 9 32
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 10 22 13 1 8 14 20 5 4 8 17 3 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 16 1 6 7 10 0 0 3 6 12 2 0 6 8 8
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 8 2 4 11 9 0 0 1 7 0 0 1 0 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
152 122 136 107
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 142 94 204
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
26 196 203 92
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 15 (6.61%)
Serine (Ser, S)
n = 21 (9.25%)
Threonine (Thr, T)
n = 15 (6.61%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 15 (6.61%)
Leucine (Leu, L)
n = 31 (13.66%)
Isoleucine (Ile, I)
n = 18 (7.93%)
Methionine (Met, M)
n = 10 (4.41%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 8 (3.52%)
Tyrosine (Tyr, Y)
n = 8 (3.52%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 12 (5.29%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 4 (1.76%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 9 (3.96%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 15 9 7 4 15 0 5 8 0 4 6 5 0 3 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 3 4 3 8 0 0 4 4 0 2 5 6 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 7 1 0 10 7 0 0 4 1 7 1 0 1 3 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 13 2 2 10 4 0 1 1 3 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
65 61 55 47
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 60 61 82
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 94 99 30
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.31%)
Alanine (Ala, A)
n = 22 (8.46%)
Serine (Ser, S)
n = 19 (7.31%)
Threonine (Thr, T)
n = 21 (8.08%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 13 (5.0%)
Leucine (Leu, L)
n = 34 (13.08%)
Isoleucine (Ile, I)
n = 17 (6.54%)
Methionine (Met, M)
n = 7 (2.69%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 5 (1.92%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 15 (5.77%)
Lysine (Lys, K)
n = 4 (1.54%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 16 6 6 9 12 2 5 8 0 3 4 6 0 3 21
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 1 8 13 0 2 5 10 2 1 6 5 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 15 0 1 8 3 1 1 5 3 8 1 0 1 4 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 6 2 0 4 4 0 0 0 5 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 69 60 66
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 68 55 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 117 109 26
CYTB (size: 1143 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (6.58%)
Alanine (Ala, A)
n = 26 (6.84%)
Serine (Ser, S)
n = 23 (6.05%)
Threonine (Thr, T)
n = 29 (7.63%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 15 (3.95%)
Leucine (Leu, L)
n = 70 (18.42%)
Isoleucine (Ile, I)
n = 30 (7.89%)
Methionine (Met, M)
n = 10 (2.63%)
Proline (Pro, P)
n = 26 (6.84%)
Phenylalanine (Phe, F)
n = 26 (6.84%)
Tyrosine (Tyr, Y)
n = 13 (3.42%)
Tryptophan (Trp, W)
n = 11 (2.89%)
Aspartic acid (Asp, D)
n = 6 (1.58%)
Glutamic acid (Glu, E)
n = 7 (1.84%)
Asparagine (Asn, N)
n = 21 (5.53%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 12 (3.16%)
Lysine (Lys, K)
n = 10 (2.63%)
Arginine (Arg, R)
n = 9 (2.37%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 22 6 6 26 32 3 3 5 3 2 5 7 1 5 21
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 2 4 16 6 0 1 11 10 3 2 13 10 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 11 0 1 11 9 1 0 1 2 11 1 0 2 19 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 6 1 3 3 9 1 1 4 3 1 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
79 122 101 79
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
49 103 78 151
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 193 128 40
ND1 (size: 978 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (4.0%)
Alanine (Ala, A)
n = 29 (8.92%)
Serine (Ser, S)
n = 30 (9.23%)
Threonine (Thr, T)
n = 25 (7.69%)
Cysteine (Cys, C)
n = 3 (0.92%)
Valine (Val, V)
n = 14 (4.31%)
Leucine (Leu, L)
n = 64 (19.69%)
Isoleucine (Ile, I)
n = 24 (7.38%)
Methionine (Met, M)
n = 11 (3.38%)
Proline (Pro, P)
n = 24 (7.38%)
Phenylalanine (Phe, F)
n = 18 (5.54%)
Tyrosine (Tyr, Y)
n = 13 (4.0%)
Tryptophan (Trp, W)
n = 9 (2.77%)
Aspartic acid (Asp, D)
n = 5 (1.54%)
Glutamic acid (Glu, E)
n = 11 (3.38%)
Asparagine (Asn, N)
n = 10 (3.08%)
Glutamine (Gln, Q)
n = 5 (1.54%)
Histidine (His, H)
n = 2 (0.62%)
Lysine (Lys, K)
n = 7 (2.15%)
Arginine (Arg, R)
n = 8 (2.46%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 18 6 8 13 27 5 8 5 0 3 3 7 1 5 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 3 6 11 11 1 2 5 6 0 4 10 9 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 8 1 4 15 5 0 1 5 7 6 4 3 1 9 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 9 2 1 4 7 0 1 3 2 2 1 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
72 92 84 78
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
40 102 53 131
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
25 132 116 53
ND2 (size: 1041 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (3.18%)
Alanine (Ala, A)
n = 30 (8.67%)
Serine (Ser, S)
n = 30 (8.67%)
Threonine (Thr, T)
n = 47 (13.58%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 7 (2.02%)
Leucine (Leu, L)
n = 66 (19.08%)
Isoleucine (Ile, I)
n = 30 (8.67%)
Methionine (Met, M)
n = 17 (4.91%)
Proline (Pro, P)
n = 21 (6.07%)
Phenylalanine (Phe, F)
n = 14 (4.05%)
Tyrosine (Tyr, Y)
n = 7 (2.02%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 12 (3.47%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 10 (2.89%)
Lysine (Lys, K)
n = 15 (4.34%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 22 12 6 13 36 4 7 7 2 1 2 3 1 4 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 1 2 16 11 1 1 4 4 2 4 7 6 4 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 20 1 4 8 13 0 0 5 2 5 2 0 3 9 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 2 3 1 0 11 4 0 1 1 1 0 0 0 1 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
54 102 126 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 123 60 134
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
31 130 141 45
ND3 (size: 1041 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (3.18%)
Alanine (Ala, A)
n = 30 (8.67%)
Serine (Ser, S)
n = 30 (8.67%)
Threonine (Thr, T)
n = 47 (13.58%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 7 (2.02%)
Leucine (Leu, L)
n = 66 (19.08%)
Isoleucine (Ile, I)
n = 30 (8.67%)
Methionine (Met, M)
n = 17 (4.91%)
Proline (Pro, P)
n = 21 (6.07%)
Phenylalanine (Phe, F)
n = 14 (4.05%)
Tyrosine (Tyr, Y)
n = 7 (2.02%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 12 (3.47%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 10 (2.89%)
Lysine (Lys, K)
n = 15 (4.34%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 22 12 6 13 36 4 7 7 2 1 2 3 1 4 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 1 2 16 11 1 1 4 4 2 4 7 6 4 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 20 1 4 8 13 0 0 5 2 5 2 0 3 9 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 2 3 1 0 11 4 0 1 1 1 0 0 0 1 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
54 102 126 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 123 60 134
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
31 130 141 45
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (4.15%)
Alanine (Ala, A)
n = 31 (6.77%)
Serine (Ser, S)
n = 34 (7.42%)
Threonine (Thr, T)
n = 58 (12.66%)
Cysteine (Cys, C)
n = 4 (0.87%)
Valine (Val, V)
n = 8 (1.75%)
Leucine (Leu, L)
n = 101 (22.05%)
Isoleucine (Ile, I)
n = 39 (8.52%)
Methionine (Met, M)
n = 22 (4.8%)
Proline (Pro, P)
n = 28 (6.11%)
Phenylalanine (Phe, F)
n = 15 (3.28%)
Tyrosine (Tyr, Y)
n = 13 (2.84%)
Tryptophan (Trp, W)
n = 12 (2.62%)
Aspartic acid (Asp, D)
n = 2 (0.44%)
Glutamic acid (Glu, E)
n = 9 (1.97%)
Asparagine (Asn, N)
n = 12 (2.62%)
Glutamine (Gln, Q)
n = 14 (3.06%)
Histidine (His, H)
n = 17 (3.71%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 29 17 11 29 41 5 12 11 3 0 3 5 0 3 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 3 8 11 12 0 4 8 6 1 1 15 11 1 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
28 19 3 3 9 13 0 2 7 4 9 1 3 1 11 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 9 0 1 1 8 2 1 2 8 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 156 150 84
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
55 142 77 185
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 190 183 62
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 9 (9.18%)
Serine (Ser, S)
n = 13 (13.27%)
Threonine (Thr, T)
n = 8 (8.16%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 1 (1.02%)
Leucine (Leu, L)
n = 20 (20.41%)
Isoleucine (Ile, I)
n = 4 (4.08%)
Methionine (Met, M)
n = 8 (8.16%)
Proline (Pro, P)
n = 4 (4.08%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 2 (2.04%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 3 (3.06%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 6 (6.12%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 4 5 3 2 14 1 0 2 0 0 0 1 0 1 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 3 2 3 4 0 0 3 1 0 0 3 1 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 4 0 2 2 5 0 0 4 0 2 0 0 1 2 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 3 0 0 1 0 0 0 1 1 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
18 34 27 20
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
14 30 18 37
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 41 43 11
ND5 (size: 1815 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 33 (5.46%)
Alanine (Ala, A)
n = 48 (7.95%)
Serine (Ser, S)
n = 49 (8.11%)
Threonine (Thr, T)
n = 70 (11.59%)
Cysteine (Cys, C)
n = 5 (0.83%)
Valine (Val, V)
n = 10 (1.66%)
Leucine (Leu, L)
n = 107 (17.72%)
Isoleucine (Ile, I)
n = 53 (8.77%)
Methionine (Met, M)
n = 33 (5.46%)
Proline (Pro, P)
n = 30 (4.97%)
Phenylalanine (Phe, F)
n = 31 (5.13%)
Tyrosine (Tyr, Y)
n = 15 (2.48%)
Tryptophan (Trp, W)
n = 12 (1.99%)
Aspartic acid (Asp, D)
n = 9 (1.49%)
Glutamic acid (Glu, E)
n = 11 (1.82%)
Asparagine (Asn, N)
n = 28 (4.64%)
Glutamine (Gln, Q)
n = 20 (3.31%)
Histidine (His, H)
n = 11 (1.82%)
Lysine (Lys, K)
n = 20 (3.31%)
Arginine (Arg, R)
n = 9 (1.49%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 40 29 10 33 48 8 8 15 5 0 4 6 0 5 26
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 2 3 8 31 9 0 5 13 14 1 1 10 18 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
37 25 2 4 15 16 0 2 12 2 13 1 0 5 23 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 9 2 2 7 18 2 1 4 4 0 1 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
111 169 219 106
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
74 183 114 234
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
26 280 231 68
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 29 (16.76%)
Alanine (Ala, A)
n = 10 (5.78%)
Serine (Ser, S)
n = 12 (6.94%)
Threonine (Thr, T)
n = 3 (1.73%)
Cysteine (Cys, C)
n = 3 (1.73%)
Valine (Val, V)
n = 35 (20.23%)
Leucine (Leu, L)
n = 28 (16.18%)
Isoleucine (Ile, I)
n = 4 (2.31%)
Methionine (Met, M)
n = 4 (2.31%)
Proline (Pro, P)
n = 4 (2.31%)
Phenylalanine (Phe, F)
n = 14 (8.09%)
Tyrosine (Tyr, Y)
n = 8 (4.62%)
Tryptophan (Trp, W)
n = 5 (2.89%)
Aspartic acid (Asp, D)
n = 4 (2.31%)
Glutamic acid (Glu, E)
n = 3 (1.73%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 1 (0.58%)
Arginine (Arg, R)
n = 5 (2.89%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 0 1 3 0 2 2 13 0 0 17 1 4 13 14 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 1 5 0 3 2 7 0 6 16 2 0 1 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 1 7 1 1 1 2 0 4 4 2 8 1 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 2 3 1 0 1 1 0 1 3 0 1 0 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
81 16 16 61
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
45 27 17 85
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
56 8 36 74
Total protein-coding genes (size: 11396 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 221 (5.82%)
Alanine (Ala, A)
n = 294 (7.74%)
Serine (Ser, S)
n = 279 (7.35%)
Threonine (Thr, T)
n = 366 (9.64%)
Cysteine (Cys, C)
n = 30 (0.79%)
Valine (Val, V)
n = 162 (4.27%)
Leucine (Leu, L)
n = 681 (17.94%)
Isoleucine (Ile, I)
n = 289 (7.61%)
Methionine (Met, M)
n = 163 (4.29%)
Proline (Pro, P)
n = 226 (5.95%)
Phenylalanine (Phe, F)
n = 212 (5.58%)
Tyrosine (Tyr, Y)
n = 113 (2.98%)
Tryptophan (Trp, W)
n = 108 (2.84%)
Aspartic acid (Asp, D)
n = 63 (1.66%)
Glutamic acid (Glu, E)
n = 92 (2.42%)
Asparagine (Asn, N)
n = 126 (3.32%)
Glutamine (Gln, Q)
n = 97 (2.55%)
Histidine (His, H)
n = 105 (2.77%)
Lysine (Lys, K)
n = 88 (2.32%)
Arginine (Arg, R)
n = 72 (1.9%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
73 216 125 77 171 301 38 79 80 17 36 43 65 18 55 157
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
38 7 23 52 134 103 5 32 73 86 30 27 86 99 14 44
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
165 146 11 35 96 86 4 8 50 34 79 16 15 24 102 22
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
83 74 18 17 46 76 12 6 22 37 7 2 2 6 1 92
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
832 1087 1094 785
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
493 1107 691 1507
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
246 1546 1457 549

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.