Viewing data for Anguilla bicolor


Scientific name Anguilla bicolor
Common name Indonesian shortfin eel
Maximum lifespan 20.00 years (Anguilla bicolor@AnAge)

Total mtDNA (size: 16700 bases) GC AT G C A T
Base content (bases) 6870 9830 4308 2562 4132 5698
Base content per 1 kb (bases) 411 589 258 153 247 341
Base content (%) 41.1% 58.9%
Total protein-coding genes (size: 11447 bases) GC AT G C A T
Base content (bases) 4700 6747 3095 1605 2950 3797
Base content per 1 kb (bases) 411 589 270 140 258 332
Base content (%) 41.1% 58.9%
D-loop (size: 978 bases) GC AT G C A T
Base content (bases) 313 665 190 123 277 388
Base content per 1 kb (bases) 320 680 194 126 283 397
Base content (%) 32.0% 68.0%
Total tRNA-coding genes (size: 1562 bases) GC AT G C A T
Base content (bases) 663 899 374 289 389 510
Base content per 1 kb (bases) 424 576 239 185 249 327
Base content (%) 42.4% 57.6%
Total rRNA-coding genes (size: 2652 bases) GC AT G C A T
Base content (bases) 1165 1487 635 530 502 985
Base content per 1 kb (bases) 439 561 239 200 189 371
Base content (%) 43.9% 56.1%
12S rRNA gene (size: 948 bases) GC AT G C A T
Base content (bases) 441 507 241 200 183 324
Base content per 1 kb (bases) 465 535 254 211 193 342
Base content (%) 46.5% 53.5%
16S rRNA gene (size: 1704 bases) GC AT G C A T
Base content (bases) 724 980 394 330 319 661
Base content per 1 kb (bases) 425 575 231 194 187 388
Base content (%) 42.5% 57.5%

ATP6 (size: 683 bases) GC AT G C A T
Base content (bases) 259 424 177 82 207 217
Base content per 1 kb (bases) 379 621 259 120 303 318
Base content (%) 37.9% 62.1%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 69 99 45 24 42 57
Base content per 1 kb (bases) 411 589 268 143 250 339
Base content (%) 41.1% 58.9%
COX1 (size: 1593 bases) GC AT G C A T
Base content (bases) 684 909 401 283 454 455
Base content per 1 kb (bases) 429 571 252 178 285 286
Base content (%) 42.9% 57.1%
COX2 (size: 691 bases) GC AT G C A T
Base content (bases) 290 401 175 115 175 226
Base content per 1 kb (bases) 420 580 253 166 253 327
Base content (%) 42.0% 58.0%
COX3 (size: 785 bases) GC AT G C A T
Base content (bases) 338 447 212 126 208 239
Base content per 1 kb (bases) 431 569 270 161 265 304
Base content (%) 43.1% 56.9%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 470 670 310 160 313 357
Base content per 1 kb (bases) 412 588 272 140 275 313
Base content (%) 41.2% 58.8%
ND1 (size: 972 bases) GC AT G C A T
Base content (bases) 413 559 281 132 248 311
Base content per 1 kb (bases) 425 575 289 136 255 320
Base content (%) 42.5% 57.5%
ND2 (size: 1045 bases) GC AT G C A T
Base content (bases) 404 641 282 122 234 407
Base content per 1 kb (bases) 387 613 270 117 224 389
Base content (%) 38.7% 61.3%
ND3 (size: 349 bases) GC AT G C A T
Base content (bases) 143 206 96 47 106 100
Base content per 1 kb (bases) 410 590 275 135 304 287
Base content (%) 41.0% 59.0%
ND4 (size: 1381 bases) GC AT G C A T
Base content (bases) 562 819 375 187 357 462
Base content per 1 kb (bases) 407 593 272 135 259 335
Base content (%) 40.7% 59.3%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 135 162 98 37 78 84
Base content per 1 kb (bases) 455 545 330 125 263 283
Base content (%) 45.5% 54.5%
ND5 (size: 1842 bases) GC AT G C A T
Base content (bases) 734 1108 493 241 460 648
Base content per 1 kb (bases) 398 602 268 131 250 352
Base content (%) 39.8% 60.2%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 204 318 153 51 74 244
Base content per 1 kb (bases) 391 609 293 98 142 467
Base content (%) 39.1% 60.9%

ATP6 (size: 683 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.87%)
Alanine (Ala, A)
n = 15 (6.64%)
Serine (Ser, S)
n = 8 (3.54%)
Threonine (Thr, T)
n = 25 (11.06%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 15 (6.64%)
Leucine (Leu, L)
n = 53 (23.45%)
Isoleucine (Ile, I)
n = 18 (7.96%)
Methionine (Met, M)
n = 11 (4.87%)
Proline (Pro, P)
n = 16 (7.08%)
Phenylalanine (Phe, F)
n = 14 (6.19%)
Tyrosine (Tyr, Y)
n = 3 (1.33%)
Tryptophan (Trp, W)
n = 5 (2.21%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.77%)
Asparagine (Asn, N)
n = 9 (3.98%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 3 (1.33%)
Lysine (Lys, K)
n = 1 (0.44%)
Arginine (Arg, R)
n = 6 (2.65%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 5 7 9 5 23 4 11 9 0 1 3 11 0 6 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 4 3 7 1 3 1 7 0 3 1 12 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 16 0 2 2 0 0 1 3 1 2 0 1 4 5 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 4 0 0 1 1 0 1 0 5 0 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
46 75 68 38
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 60 30 111
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 42 118 57
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPAPWFTILVLSWAVFLAILPTKVMAHTFNNEPNLQTAKKPKMDSWNWPWY*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 5 (9.09%)
Serine (Ser, S)
n = 2 (3.64%)
Threonine (Thr, T)
n = 4 (7.27%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 3 (5.45%)
Leucine (Leu, L)
n = 6 (10.91%)
Isoleucine (Ile, I)
n = 2 (3.64%)
Methionine (Met, M)
n = 3 (5.45%)
Proline (Pro, P)
n = 7 (12.73%)
Phenylalanine (Phe, F)
n = 3 (5.45%)
Tyrosine (Tyr, Y)
n = 1 (1.82%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 1 (1.82%)
Glutamic acid (Glu, E)
n = 1 (1.82%)
Asparagine (Asn, N)
n = 5 (9.09%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 1 (1.82%)
Lysine (Lys, K)
n = 4 (7.27%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 0 2 0 2 2 1 1 1 1 0 0 1 2 1 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 3 0 1 1 0 0 0 0 0 3 4 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 1 1 1 0 1 0 0 0 0 1 1 0 3 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 0 1 0 1 4 0 0 0 0 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
10 15 18 13
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 18 16 17
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 12 23 12
COX1 (size: 1593 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 48 (9.06%)
Alanine (Ala, A)
n = 47 (8.87%)
Serine (Ser, S)
n = 27 (5.09%)
Threonine (Thr, T)
n = 38 (7.17%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 44 (8.3%)
Leucine (Leu, L)
n = 62 (11.7%)
Isoleucine (Ile, I)
n = 38 (7.17%)
Methionine (Met, M)
n = 23 (4.34%)
Proline (Pro, P)
n = 30 (5.66%)
Phenylalanine (Phe, F)
n = 41 (7.74%)
Tyrosine (Tyr, Y)
n = 19 (3.58%)
Tryptophan (Trp, W)
n = 18 (3.4%)
Aspartic acid (Asp, D)
n = 17 (3.21%)
Glutamic acid (Glu, E)
n = 14 (2.64%)
Asparagine (Asn, N)
n = 14 (2.64%)
Glutamine (Gln, Q)
n = 8 (1.51%)
Histidine (His, H)
n = 20 (3.77%)
Lysine (Lys, K)
n = 12 (2.26%)
Arginine (Arg, R)
n = 9 (1.7%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 16 16 10 8 24 8 11 8 0 10 7 25 2 18 23
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 1 0 12 19 14 2 9 6 26 7 5 6 17 2 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 21 0 4 7 12 0 1 3 9 10 0 1 8 6 8
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 12 2 4 13 12 0 4 0 5 0 0 1 0 0 18
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
170 117 130 114
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
81 138 104 208
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
32 146 221 132
COX2 (size: 691 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.93%)
Alanine (Ala, A)
n = 19 (8.3%)
Serine (Ser, S)
n = 14 (6.11%)
Threonine (Thr, T)
n = 10 (4.37%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 21 (9.17%)
Leucine (Leu, L)
n = 27 (11.79%)
Isoleucine (Ile, I)
n = 18 (7.86%)
Methionine (Met, M)
n = 13 (5.68%)
Proline (Pro, P)
n = 14 (6.11%)
Phenylalanine (Phe, F)
n = 9 (3.93%)
Tyrosine (Tyr, Y)
n = 9 (3.93%)
Tryptophan (Trp, W)
n = 5 (2.18%)
Aspartic acid (Asp, D)
n = 13 (5.68%)
Glutamic acid (Glu, E)
n = 14 (6.11%)
Asparagine (Asn, N)
n = 5 (2.18%)
Glutamine (Gln, Q)
n = 9 (3.93%)
Histidine (His, H)
n = 10 (4.37%)
Lysine (Lys, K)
n = 3 (1.31%)
Arginine (Arg, R)
n = 6 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 7 8 4 1 13 2 7 8 1 5 3 10 3 4 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 2 0 5 13 1 1 1 7 0 3 3 8 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 5 0 1 3 6 1 0 3 4 5 0 0 0 5 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 13 1 1 12 3 0 0 1 5 0 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
76 59 52 43
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 54 63 88
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 62 111 43
COX3 (size: 785 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (8.08%)
Alanine (Ala, A)
n = 21 (8.08%)
Serine (Ser, S)
n = 13 (5.0%)
Threonine (Thr, T)
n = 25 (9.62%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 17 (6.54%)
Leucine (Leu, L)
n = 31 (11.92%)
Isoleucine (Ile, I)
n = 15 (5.77%)
Methionine (Met, M)
n = 9 (3.46%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 23 (8.85%)
Tyrosine (Tyr, Y)
n = 12 (4.62%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 10 (3.85%)
Asparagine (Asn, N)
n = 1 (0.38%)
Glutamine (Gln, Q)
n = 9 (3.46%)
Histidine (His, H)
n = 15 (5.77%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 7 8 2 3 21 2 3 9 0 4 4 7 2 9 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 1 2 11 8 0 2 6 12 1 1 1 10 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 15 0 1 1 8 0 0 3 8 4 1 0 0 1 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 8 2 1 4 3 0 0 1 4 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 69 56 62
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 68 55 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 75 127 50
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (6.86%)
Alanine (Ala, A)
n = 27 (7.12%)
Serine (Ser, S)
n = 24 (6.33%)
Threonine (Thr, T)
n = 20 (5.28%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 29 (7.65%)
Leucine (Leu, L)
n = 59 (15.57%)
Isoleucine (Ile, I)
n = 26 (6.86%)
Methionine (Met, M)
n = 14 (3.69%)
Proline (Pro, P)
n = 22 (5.8%)
Phenylalanine (Phe, F)
n = 28 (7.39%)
Tyrosine (Tyr, Y)
n = 16 (4.22%)
Tryptophan (Trp, W)
n = 13 (3.43%)
Aspartic acid (Asp, D)
n = 12 (3.17%)
Glutamic acid (Glu, E)
n = 5 (1.32%)
Asparagine (Asn, N)
n = 20 (5.28%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 14 13 13 2 30 3 11 6 0 3 4 20 2 5 23
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 2 1 3 14 10 0 2 4 19 1 1 1 19 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 11 0 3 5 15 1 0 0 4 12 1 0 5 15 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 5 0 3 9 8 1 0 1 7 0 0 0 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
99 96 89 96
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
50 93 81 156
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 121 187 61
ND1 (size: 972 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.57%)
Alanine (Ala, A)
n = 32 (9.91%)
Serine (Ser, S)
n = 19 (5.88%)
Threonine (Thr, T)
n = 23 (7.12%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 19 (5.88%)
Leucine (Leu, L)
n = 60 (18.58%)
Isoleucine (Ile, I)
n = 21 (6.5%)
Methionine (Met, M)
n = 16 (4.95%)
Proline (Pro, P)
n = 24 (7.43%)
Phenylalanine (Phe, F)
n = 16 (4.95%)
Tyrosine (Tyr, Y)
n = 12 (3.72%)
Tryptophan (Trp, W)
n = 8 (2.48%)
Aspartic acid (Asp, D)
n = 3 (0.93%)
Glutamic acid (Glu, E)
n = 12 (3.72%)
Asparagine (Asn, N)
n = 16 (4.95%)
Glutamine (Gln, Q)
n = 5 (1.55%)
Histidine (His, H)
n = 3 (0.93%)
Lysine (Lys, K)
n = 8 (2.48%)
Arginine (Arg, R)
n = 8 (2.48%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 13 13 11 6 33 1 8 5 0 2 4 12 1 8 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 4 17 10 1 1 6 10 1 3 1 18 2 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 11 0 3 2 11 1 0 2 5 7 1 1 4 12 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 12 0 0 3 8 0 2 0 6 0 0 0 1 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
84 91 86 63
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 96 60 132
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 94 165 53
ND2 (size: 1045 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (5.48%)
Alanine (Ala, A)
n = 30 (8.65%)
Serine (Ser, S)
n = 18 (5.19%)
Threonine (Thr, T)
n = 48 (13.83%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 9 (2.59%)
Leucine (Leu, L)
n = 55 (15.85%)
Isoleucine (Ile, I)
n = 28 (8.07%)
Methionine (Met, M)
n = 37 (10.66%)
Proline (Pro, P)
n = 20 (5.76%)
Phenylalanine (Phe, F)
n = 9 (2.59%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 6 (1.73%)
Asparagine (Asn, N)
n = 10 (2.88%)
Glutamine (Gln, Q)
n = 14 (4.03%)
Histidine (His, H)
n = 6 (1.73%)
Lysine (Lys, K)
n = 13 (3.75%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 13 33 4 5 35 5 6 13 1 1 1 7 0 1 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 0 7 11 12 0 0 4 11 4 2 3 14 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 33 1 1 2 11 0 0 4 6 2 0 0 4 6 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 6 0 1 1 12 1 0 0 4 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 93 140 49
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 112 59 138
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 77 208 46
ND3 (size: 1045 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (5.48%)
Alanine (Ala, A)
n = 30 (8.65%)
Serine (Ser, S)
n = 18 (5.19%)
Threonine (Thr, T)
n = 48 (13.83%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 9 (2.59%)
Leucine (Leu, L)
n = 55 (15.85%)
Isoleucine (Ile, I)
n = 28 (8.07%)
Methionine (Met, M)
n = 37 (10.66%)
Proline (Pro, P)
n = 20 (5.76%)
Phenylalanine (Phe, F)
n = 9 (2.59%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 6 (1.73%)
Asparagine (Asn, N)
n = 10 (2.88%)
Glutamine (Gln, Q)
n = 14 (4.03%)
Histidine (His, H)
n = 6 (1.73%)
Lysine (Lys, K)
n = 13 (3.75%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 13 33 4 5 35 5 6 13 1 1 1 7 0 1 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 0 7 11 12 0 0 4 11 4 2 3 14 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 33 1 1 2 11 0 0 4 6 2 0 0 4 6 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 6 0 1 1 12 1 0 0 4 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 93 140 49
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 112 59 138
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 77 208 46
ND4 (size: 1381 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 29 (6.32%)
Alanine (Ala, A)
n = 34 (7.41%)
Serine (Ser, S)
n = 28 (6.1%)
Threonine (Thr, T)
n = 39 (8.5%)
Cysteine (Cys, C)
n = 5 (1.09%)
Valine (Val, V)
n = 17 (3.7%)
Leucine (Leu, L)
n = 86 (18.74%)
Isoleucine (Ile, I)
n = 43 (9.37%)
Methionine (Met, M)
n = 29 (6.32%)
Proline (Pro, P)
n = 24 (5.23%)
Phenylalanine (Phe, F)
n = 15 (3.27%)
Tyrosine (Tyr, Y)
n = 15 (3.27%)
Tryptophan (Trp, W)
n = 20 (4.36%)
Aspartic acid (Asp, D)
n = 5 (1.09%)
Glutamic acid (Glu, E)
n = 12 (2.61%)
Asparagine (Asn, N)
n = 13 (2.83%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 10 (2.18%)
Lysine (Lys, K)
n = 13 (2.83%)
Arginine (Arg, R)
n = 12 (2.61%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
25 18 22 9 11 43 4 19 11 0 2 3 11 1 4 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 1 4 4 13 17 0 4 5 17 3 2 5 17 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 19 0 2 7 14 0 0 5 6 9 3 0 2 11 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 12 0 1 4 13 0 0 2 9 1 0 0 0 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
97 124 142 97
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
71 120 79 190
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 131 241 69
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 13 (13.27%)
Serine (Ser, S)
n = 11 (11.22%)
Threonine (Thr, T)
n = 8 (8.16%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 2 (2.04%)
Leucine (Leu, L)
n = 20 (20.41%)
Isoleucine (Ile, I)
n = 1 (1.02%)
Methionine (Met, M)
n = 8 (8.16%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 8 (8.16%)
Tyrosine (Tyr, Y)
n = 1 (1.02%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 5 (5.1%)
Lysine (Lys, K)
n = 1 (1.02%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 0 7 3 2 12 0 2 2 0 0 0 2 0 2 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 3 1 8 4 0 0 3 1 0 0 1 1 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 4 0 1 4 4 0 0 2 1 0 0 1 0 2 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 3 0 1 0 1 0 1 0 1 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
23 28 22 26
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
12 32 16 39
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 38 46 13
ND5 (size: 1842 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 31 (5.06%)
Alanine (Ala, A)
n = 49 (7.99%)
Serine (Ser, S)
n = 35 (5.71%)
Threonine (Thr, T)
n = 57 (9.3%)
Cysteine (Cys, C)
n = 6 (0.98%)
Valine (Val, V)
n = 31 (5.06%)
Leucine (Leu, L)
n = 88 (14.36%)
Isoleucine (Ile, I)
n = 52 (8.48%)
Methionine (Met, M)
n = 38 (6.2%)
Proline (Pro, P)
n = 31 (5.06%)
Phenylalanine (Phe, F)
n = 40 (6.53%)
Tyrosine (Tyr, Y)
n = 12 (1.96%)
Tryptophan (Trp, W)
n = 14 (2.28%)
Aspartic acid (Asp, D)
n = 13 (2.12%)
Glutamic acid (Glu, E)
n = 12 (1.96%)
Asparagine (Asn, N)
n = 34 (5.55%)
Glutamine (Gln, Q)
n = 22 (3.59%)
Histidine (His, H)
n = 13 (2.12%)
Lysine (Lys, K)
n = 26 (4.24%)
Arginine (Arg, R)
n = 9 (1.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 31 30 7 12 43 8 15 21 1 6 7 17 1 17 23
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 3 3 4 23 21 1 3 8 17 3 2 2 26 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 35 2 4 4 15 1 2 9 1 11 3 3 5 29 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 11 1 8 5 26 0 0 0 8 1 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
136 145 218 115
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
71 161 133 249
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
34 187 297 96
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (14.45%)
Alanine (Ala, A)
n = 16 (9.25%)
Serine (Ser, S)
n = 11 (6.36%)
Threonine (Thr, T)
n = 2 (1.16%)
Cysteine (Cys, C)
n = 5 (2.89%)
Valine (Val, V)
n = 19 (10.98%)
Leucine (Leu, L)
n = 28 (16.18%)
Isoleucine (Ile, I)
n = 10 (5.78%)
Methionine (Met, M)
n = 4 (2.31%)
Proline (Pro, P)
n = 4 (2.31%)
Phenylalanine (Phe, F)
n = 15 (8.67%)
Tyrosine (Tyr, Y)
n = 13 (7.51%)
Tryptophan (Trp, W)
n = 4 (2.31%)
Aspartic acid (Asp, D)
n = 5 (2.89%)
Glutamic acid (Glu, E)
n = 5 (2.89%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 6 (3.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 0 1 7 0 2 0 7 0 0 9 0 4 6 15 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 5 0 11 1 4 0 10 1 4 10 3 0 1 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 0 5 0 1 2 3 0 13 0 3 12 1 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 3 2 5 0 0 0 4 0 1 1 0 0 0 1 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 19 20 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 30 25 76
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
40 2 29 103
Total protein-coding genes (size: 11468 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 247 (6.47%)
Alanine (Ala, A)
n = 313 (8.2%)
Serine (Ser, S)
n = 219 (5.73%)
Threonine (Thr, T)
n = 306 (8.01%)
Cysteine (Cys, C)
n = 30 (0.79%)
Valine (Val, V)
n = 231 (6.05%)
Leucine (Leu, L)
n = 597 (15.63%)
Isoleucine (Ile, I)
n = 284 (7.44%)
Methionine (Met, M)
n = 209 (5.47%)
Proline (Pro, P)
n = 215 (5.63%)
Phenylalanine (Phe, F)
n = 229 (6.0%)
Tyrosine (Tyr, Y)
n = 123 (3.22%)
Tryptophan (Trp, W)
n = 121 (3.17%)
Aspartic acid (Asp, D)
n = 83 (2.17%)
Glutamic acid (Glu, E)
n = 104 (2.72%)
Asparagine (Asn, N)
n = 133 (3.48%)
Glutamine (Gln, Q)
n = 100 (2.62%)
Histidine (His, H)
n = 98 (2.57%)
Lysine (Lys, K)
n = 94 (2.46%)
Arginine (Arg, R)
n = 77 (2.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
158 126 163 82 62 291 40 103 95 5 43 37 131 20 95 134
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
46 14 16 57 126 123 7 35 46 135 31 27 28 153 7 44
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
85 173 4 28 41 103 6 7 34 59 64 13 19 37 96 37
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
61 95 9 26 57 92 2 12 6 56 3 0 1 5 1 108
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
978 965 1068 809
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
517 1012 741 1550
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
214 1019 1826 761

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.