Viewing data for Capra ibex


Scientific name Capra ibex
Common name Ibex
Maximum lifespan 20.90 years (Capra ibex@AnAge)

Total mtDNA (size: 16716 bases) GC AT G C A T
Base content (bases) 6615 10101 4428 2187 4498 5603
Base content per 1 kb (bases) 396 604 265 131 269 335
Base content (%) 39.6% 60.4%
Total protein-coding genes (size: 11334 bases) GC AT G C A T
Base content (bases) 4534 6800 3210 1324 3104 3696
Base content per 1 kb (bases) 400 600 283 117 274 326
Base content (%) 40.0% 60.0%
D-loop (size: 1113 bases) GC AT G C A T
Base content (bases) 441 672 280 161 307 365
Base content per 1 kb (bases) 396 604 252 145 276 328
Base content (%) 39.6% 60.4%
Total tRNA-coding genes (size: 1512 bases) GC AT G C A T
Base content (bases) 542 970 316 226 431 539
Base content per 1 kb (bases) 358 642 209 149 285 356
Base content (%) 35.8% 64.2%
Total rRNA-coding genes (size: 2526 bases) GC AT G C A T
Base content (bases) 997 1529 552 445 593 936
Base content per 1 kb (bases) 395 605 219 176 235 371
Base content (%) 39.5% 60.5%
12S rRNA gene (size: 956 bases) GC AT G C A T
Base content (bases) 400 556 228 172 207 349
Base content per 1 kb (bases) 418 582 238 180 217 365
Base content (%) 41.8% 58.2%
16S rRNA gene (size: 1570 bases) GC AT G C A T
Base content (bases) 597 973 324 273 386 587
Base content per 1 kb (bases) 380 620 206 174 246 374
Base content (%) 38.0% 62.0%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 264 417 194 70 193 224
Base content per 1 kb (bases) 388 612 285 103 283 329
Base content (%) 38.8% 61.2%
ATP8 (size: 198 bases) GC AT G C A T
Base content (bases) 63 135 51 12 54 81
Base content per 1 kb (bases) 318 682 258 61 273 409
Base content (%) 31.8% 68.2%
COX1 (size: 1545 bases) GC AT G C A T
Base content (bases) 649 896 397 252 453 443
Base content per 1 kb (bases) 420 580 257 163 293 287
Base content (%) 42.0% 58.0%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 262 422 168 94 184 238
Base content per 1 kb (bases) 383 617 246 137 269 348
Base content (%) 38.3% 61.7%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 352 432 239 113 224 208
Base content per 1 kb (bases) 449 551 305 144 286 265
Base content (%) 44.9% 55.1%
CYTB (size: 1139 bases) GC AT G C A T
Base content (bases) 484 655 335 149 295 360
Base content per 1 kb (bases) 425 575 294 131 259 316
Base content (%) 42.5% 57.5%
ND1 (size: 956 bases) GC AT G C A T
Base content (bases) 383 573 274 109 269 304
Base content per 1 kb (bases) 401 599 287 114 281 318
Base content (%) 40.1% 59.9%
ND2 (size: 1042 bases) GC AT G C A T
Base content (bases) 381 661 300 81 277 384
Base content per 1 kb (bases) 366 634 288 78 266 369
Base content (%) 36.6% 63.4%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 141 205 101 40 99 106
Base content per 1 kb (bases) 408 592 292 116 286 306
Base content (%) 40.8% 59.2%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 554 824 404 150 388 436
Base content per 1 kb (bases) 402 598 293 109 282 316
Base content (%) 40.2% 59.8%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 113 184 79 34 89 95
Base content per 1 kb (bases) 380 620 266 114 300 320
Base content (%) 38.0% 62.0%
ND5 (size: 1821 bases) GC AT G C A T
Base content (bases) 724 1097 533 191 484 613
Base content per 1 kb (bases) 398 602 293 105 266 337
Base content (%) 39.8% 60.2%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 183 345 148 35 118 227
Base content per 1 kb (bases) 347 653 280 66 223 430
Base content (%) 34.7% 65.3%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.87%)
Alanine (Ala, A)
n = 15 (6.64%)
Serine (Ser, S)
n = 16 (7.08%)
Threonine (Thr, T)
n = 26 (11.5%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 8 (3.54%)
Leucine (Leu, L)
n = 44 (19.47%)
Isoleucine (Ile, I)
n = 26 (11.5%)
Methionine (Met, M)
n = 11 (4.87%)
Proline (Pro, P)
n = 13 (5.75%)
Phenylalanine (Phe, F)
n = 13 (5.75%)
Tyrosine (Tyr, Y)
n = 2 (0.88%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 11 (4.87%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 6 (2.65%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 4 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 8 8 5 9 19 2 9 9 0 1 0 7 0 9 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 2 7 6 0 1 3 6 1 2 6 5 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 16 1 3 1 6 0 2 4 0 2 1 0 4 7 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 3 0 0 1 4 0 0 2 2 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
38 67 84 38
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
24 64 37 102
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 63 103 53
ATP8 (size: 198 bases)
Amino acid sequence: MPQLDTSTWLTTILSMFLALFIIFQLKISKHNFYHNPELTTKVLKQNTPWETKWTKIYLPLLLPL*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 1 (1.54%)
Serine (Ser, S)
n = 3 (4.62%)
Threonine (Thr, T)
n = 9 (13.85%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.54%)
Leucine (Leu, L)
n = 13 (20.0%)
Isoleucine (Ile, I)
n = 5 (7.69%)
Methionine (Met, M)
n = 2 (3.08%)
Proline (Pro, P)
n = 5 (7.69%)
Phenylalanine (Phe, F)
n = 4 (6.15%)
Tyrosine (Tyr, Y)
n = 2 (3.08%)
Tryptophan (Trp, W)
n = 3 (4.62%)
Aspartic acid (Asp, D)
n = 1 (1.54%)
Glutamic acid (Glu, E)
n = 2 (3.08%)
Asparagine (Asn, N)
n = 3 (4.62%)
Glutamine (Gln, Q)
n = 3 (4.62%)
Histidine (His, H)
n = 2 (3.08%)
Lysine (Lys, K)
n = 6 (9.23%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 2 1 3 1 5 0 4 3 0 0 0 1 0 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 1 0 0 0 0 0 0 0 2 1 2 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 7 1 0 0 3 0 0 0 1 1 0 0 0 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 0 0 1 5 1 0 0 0 0 0 0 0 1 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
5 19 25 17
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
3 18 20 25
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 14 36 12
COX1 (size: 1545 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.14%)
Alanine (Ala, A)
n = 41 (7.98%)
Serine (Ser, S)
n = 30 (5.84%)
Threonine (Thr, T)
n = 37 (7.2%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 35 (6.81%)
Leucine (Leu, L)
n = 60 (11.67%)
Isoleucine (Ile, I)
n = 40 (7.78%)
Methionine (Met, M)
n = 33 (6.42%)
Proline (Pro, P)
n = 28 (5.45%)
Phenylalanine (Phe, F)
n = 42 (8.17%)
Tyrosine (Tyr, Y)
n = 19 (3.7%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 16 (3.11%)
Glutamic acid (Glu, E)
n = 9 (1.75%)
Asparagine (Asn, N)
n = 19 (3.7%)
Glutamine (Gln, Q)
n = 6 (1.17%)
Histidine (His, H)
n = 17 (3.31%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 20 29 11 5 27 5 11 5 1 6 7 18 4 20 22
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 9 14 18 0 6 11 24 6 12 8 8 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 17 0 8 5 14 0 1 2 4 15 3 1 9 10 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 7 2 6 10 9 0 0 2 4 2 0 0 1 0 14
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
148 107 141 119
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 133 96 210
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 157 206 124
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 8 (3.52%)
Serine (Ser, S)
n = 21 (9.25%)
Threonine (Thr, T)
n = 18 (7.93%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 13 (5.73%)
Leucine (Leu, L)
n = 33 (14.54%)
Isoleucine (Ile, I)
n = 17 (7.49%)
Methionine (Met, M)
n = 17 (7.49%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 7 (3.08%)
Tyrosine (Tyr, Y)
n = 9 (3.96%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 10 (4.41%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 5 (2.2%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 8 (3.52%)
Lysine (Lys, K)
n = 6 (2.64%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 6 14 2 3 16 4 8 5 1 6 2 5 0 2 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 1 1 1 6 0 3 1 4 0 1 5 7 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 10 1 3 4 8 1 1 4 6 3 0 0 1 4 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 11 4 3 7 6 0 2 0 4 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
54 58 68 48
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 55 60 87
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 55 110 49
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 15 (5.77%)
Serine (Ser, S)
n = 20 (7.69%)
Threonine (Thr, T)
n = 24 (9.23%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 15 (5.77%)
Leucine (Leu, L)
n = 34 (13.08%)
Isoleucine (Ile, I)
n = 14 (5.38%)
Methionine (Met, M)
n = 8 (3.08%)
Proline (Pro, P)
n = 13 (5.0%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 6 (2.31%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 7 5 6 8 11 1 8 7 0 4 4 6 1 8 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 2 5 7 3 0 3 10 7 0 0 7 5 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 12 0 3 5 6 1 1 4 4 7 0 0 5 1 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 8 0 1 3 2 0 1 2 2 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
62 68 59 72
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 67 55 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 104 94 56
CYTB (size: 1139 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.35%)
Alanine (Ala, A)
n = 24 (6.35%)
Serine (Ser, S)
n = 20 (5.29%)
Threonine (Thr, T)
n = 30 (7.94%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 19 (5.03%)
Leucine (Leu, L)
n = 54 (14.29%)
Isoleucine (Ile, I)
n = 38 (10.05%)
Methionine (Met, M)
n = 19 (5.03%)
Proline (Pro, P)
n = 24 (6.35%)
Phenylalanine (Phe, F)
n = 26 (6.88%)
Tyrosine (Tyr, Y)
n = 15 (3.97%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 11 (2.91%)
Glutamic acid (Glu, E)
n = 6 (1.59%)
Asparagine (Asn, N)
n = 18 (4.76%)
Glutamine (Gln, Q)
n = 6 (1.59%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 9 (2.38%)
Arginine (Arg, R)
n = 8 (2.12%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 20 16 4 15 27 3 5 4 2 0 9 10 0 6 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 3 3 7 14 0 1 6 13 4 3 6 15 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 17 1 4 3 10 0 1 2 7 8 0 0 4 14 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 6 0 3 8 9 0 0 1 7 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
84 99 117 79
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
51 95 77 156
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 141 165 60
ND1 (size: 956 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.79%)
Alanine (Ala, A)
n = 28 (8.83%)
Serine (Ser, S)
n = 22 (6.94%)
Threonine (Thr, T)
n = 20 (6.31%)
Cysteine (Cys, C)
n = 1 (0.32%)
Valine (Val, V)
n = 13 (4.1%)
Leucine (Leu, L)
n = 56 (17.67%)
Isoleucine (Ile, I)
n = 33 (10.41%)
Methionine (Met, M)
n = 19 (5.99%)
Proline (Pro, P)
n = 22 (6.94%)
Phenylalanine (Phe, F)
n = 20 (6.31%)
Tyrosine (Tyr, Y)
n = 12 (3.79%)
Tryptophan (Trp, W)
n = 9 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.95%)
Glutamic acid (Glu, E)
n = 11 (3.47%)
Asparagine (Asn, N)
n = 12 (3.79%)
Glutamine (Gln, Q)
n = 7 (2.21%)
Histidine (His, H)
n = 3 (0.95%)
Lysine (Lys, K)
n = 7 (2.21%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 14 17 5 11 28 2 10 7 0 1 3 8 1 9 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 0 5 10 13 0 1 4 5 2 3 12 7 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 14 0 1 5 12 1 0 3 3 9 0 0 5 7 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 10 1 1 2 7 0 1 0 7 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 86 94 71
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 89 55 141
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 99 154 56
ND2 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 18 (5.2%)
Serine (Ser, S)
n = 27 (7.8%)
Threonine (Thr, T)
n = 43 (12.43%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 8 (2.31%)
Leucine (Leu, L)
n = 57 (16.47%)
Isoleucine (Ile, I)
n = 36 (10.4%)
Methionine (Met, M)
n = 39 (11.27%)
Proline (Pro, P)
n = 20 (5.78%)
Phenylalanine (Phe, F)
n = 14 (4.05%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 16 (4.62%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 6 (1.73%)
Lysine (Lys, K)
n = 13 (3.76%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 16 37 2 15 31 0 9 9 0 1 3 4 0 7 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 4 9 5 0 1 4 9 0 0 8 11 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 19 0 3 7 13 2 0 2 5 3 0 0 5 11 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 4 1 0 0 13 0 0 0 4 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
45 87 149 66
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 106 57 154
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 107 178 56
ND3 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 18 (5.2%)
Serine (Ser, S)
n = 27 (7.8%)
Threonine (Thr, T)
n = 43 (12.43%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 8 (2.31%)
Leucine (Leu, L)
n = 57 (16.47%)
Isoleucine (Ile, I)
n = 36 (10.4%)
Methionine (Met, M)
n = 39 (11.27%)
Proline (Pro, P)
n = 20 (5.78%)
Phenylalanine (Phe, F)
n = 14 (4.05%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 16 (4.62%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 6 (1.73%)
Lysine (Lys, K)
n = 13 (3.76%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 16 37 2 15 31 0 9 9 0 1 3 4 0 7 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 4 9 5 0 1 4 9 0 0 8 11 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 19 0 3 7 13 2 0 2 5 3 0 0 5 11 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 4 1 0 0 13 0 0 0 4 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
45 87 149 66
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 106 57 154
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 107 178 56
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.93%)
Alanine (Ala, A)
n = 29 (6.33%)
Serine (Ser, S)
n = 40 (8.73%)
Threonine (Thr, T)
n = 35 (7.64%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 15 (3.28%)
Leucine (Leu, L)
n = 93 (20.31%)
Isoleucine (Ile, I)
n = 41 (8.95%)
Methionine (Met, M)
n = 35 (7.64%)
Proline (Pro, P)
n = 22 (4.8%)
Phenylalanine (Phe, F)
n = 21 (4.59%)
Tyrosine (Tyr, Y)
n = 15 (3.28%)
Tryptophan (Trp, W)
n = 13 (2.84%)
Aspartic acid (Asp, D)
n = 4 (0.87%)
Glutamic acid (Glu, E)
n = 8 (1.75%)
Asparagine (Asn, N)
n = 22 (4.8%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 13 (2.84%)
Lysine (Lys, K)
n = 11 (2.4%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 20 31 17 16 45 4 10 10 1 2 7 5 1 6 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 2 4 11 14 0 1 8 8 1 4 7 11 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 19 2 5 12 10 1 2 10 8 7 0 1 5 17 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 6 2 1 3 11 0 3 1 3 3 0 0 0 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 138 156 91
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
56 114 84 205
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 152 196 91
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 8 (8.16%)
Serine (Ser, S)
n = 10 (10.2%)
Threonine (Thr, T)
n = 6 (6.12%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 6 (6.12%)
Leucine (Leu, L)
n = 22 (22.45%)
Isoleucine (Ile, I)
n = 5 (5.1%)
Methionine (Met, M)
n = 12 (12.24%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 4 (4.08%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 5 (5.1%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 3 10 1 3 11 1 5 2 0 1 0 5 0 1 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 3 0 3 5 0 1 1 2 0 1 0 0 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 3 0 1 6 2 0 0 1 2 2 0 1 1 4 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 1 0 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
21 22 29 27
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 24 17 49
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 33 49 13
ND5 (size: 1821 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (4.62%)
Alanine (Ala, A)
n = 43 (7.1%)
Serine (Ser, S)
n = 45 (7.43%)
Threonine (Thr, T)
n = 60 (9.9%)
Cysteine (Cys, C)
n = 5 (0.83%)
Valine (Val, V)
n = 18 (2.97%)
Leucine (Leu, L)
n = 89 (14.69%)
Isoleucine (Ile, I)
n = 58 (9.57%)
Methionine (Met, M)
n = 37 (6.11%)
Proline (Pro, P)
n = 25 (4.13%)
Phenylalanine (Phe, F)
n = 45 (7.43%)
Tyrosine (Tyr, Y)
n = 19 (3.14%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 9 (1.49%)
Glutamic acid (Glu, E)
n = 12 (1.98%)
Asparagine (Asn, N)
n = 38 (6.27%)
Glutamine (Gln, Q)
n = 19 (3.14%)
Histidine (His, H)
n = 13 (2.15%)
Lysine (Lys, K)
n = 23 (3.8%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
26 32 34 9 19 40 4 17 16 3 3 9 6 0 15 30
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 3 7 15 20 1 0 10 16 2 1 13 10 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
21 30 2 6 14 15 1 4 5 10 9 1 0 8 30 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 11 1 1 8 23 0 0 4 4 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
110 137 225 135
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
62 164 134 247
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 232 254 102
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (14.86%)
Alanine (Ala, A)
n = 7 (4.0%)
Serine (Ser, S)
n = 12 (6.86%)
Threonine (Thr, T)
n = 8 (4.57%)
Cysteine (Cys, C)
n = 1 (0.57%)
Valine (Val, V)
n = 24 (13.71%)
Leucine (Leu, L)
n = 17 (9.71%)
Isoleucine (Ile, I)
n = 14 (8.0%)
Methionine (Met, M)
n = 13 (7.43%)
Proline (Pro, P)
n = 3 (1.71%)
Phenylalanine (Phe, F)
n = 14 (8.0%)
Tyrosine (Tyr, Y)
n = 10 (5.71%)
Tryptophan (Trp, W)
n = 4 (2.29%)
Aspartic acid (Asp, D)
n = 4 (2.29%)
Glutamic acid (Glu, E)
n = 8 (4.57%)
Asparagine (Asn, N)
n = 3 (1.71%)
Glutamine (Gln, Q)
n = 1 (0.57%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 5 (2.86%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 0 6 1 0 1 0 10 1 0 13 0 6 5 13 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 1 0 4 1 0 2 12 0 3 11 3 0 0 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 1 2 5 0 1 1 5 0 9 1 1 5 3 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 6 4 0 3 2 1 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 7 48 52
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 25 32 82
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
42 3 38 93
Total protein-coding genes (size: 11399 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 215 (5.66%)
Alanine (Ala, A)
n = 248 (6.53%)
Serine (Ser, S)
n = 273 (7.19%)
Threonine (Thr, T)
n = 327 (8.61%)
Cysteine (Cys, C)
n = 23 (0.61%)
Valine (Val, V)
n = 179 (4.72%)
Leucine (Leu, L)
n = 598 (15.75%)
Isoleucine (Ile, I)
n = 332 (8.75%)
Methionine (Met, M)
n = 251 (6.61%)
Proline (Pro, P)
n = 195 (5.14%)
Phenylalanine (Phe, F)
n = 242 (6.38%)
Tyrosine (Tyr, Y)
n = 129 (3.4%)
Tryptophan (Trp, W)
n = 104 (2.74%)
Aspartic acid (Asp, D)
n = 66 (1.74%)
Glutamic acid (Glu, E)
n = 95 (2.5%)
Asparagine (Asn, N)
n = 163 (4.29%)
Glutamine (Gln, Q)
n = 89 (2.34%)
Histidine (His, H)
n = 99 (2.61%)
Lysine (Lys, K)
n = 98 (2.58%)
Arginine (Arg, R)
n = 64 (1.69%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
182 150 213 72 111 272 27 108 81 8 39 44 84 12 103 139
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
38 7 16 48 91 106 3 30 58 100 27 32 76 84 3 48
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
98 171 10 43 64 102 8 17 39 60 69 6 8 53 110 28
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
71 77 18 21 45 95 3 8 13 38 5 0 0 6 1 98
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
803 929 1227 838
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
462 987 746 1602
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
177 1194 1635 791

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.