Viewing data for Varanus niloticus


Scientific name Varanus niloticus
Common name Nile monitor
Maximum lifespan 14.60 years (Varanus niloticus@AnAge)

Total mtDNA (size: 18511 bases) GC AT G C A T
Base content (bases) 7615 10896 5274 2341 5015 5881
Base content per 1 kb (bases) 411 589 285 126 271 318
Base content (%) 41.1% 58.9%
Total protein-coding genes (size: 11397 bases) GC AT G C A T
Base content (bases) 4767 6630 3513 1254 2984 3646
Base content per 1 kb (bases) 418 582 308 110 262 320
Base content (%) 41.8% 58.2%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1487 bases) GC AT G C A T
Base content (bases) 607 880 380 227 377 503
Base content per 1 kb (bases) 408 592 256 153 254 338
Base content (%) 40.8% 59.2%
Total rRNA-coding genes (size: 2474 bases) GC AT G C A T
Base content (bases) 1072 1402 673 399 512 890
Base content per 1 kb (bases) 433 567 272 161 207 360
Base content (%) 43.3% 56.7%
12S rRNA gene (size: 947 bases) GC AT G C A T
Base content (bases) 409 538 248 161 195 343
Base content per 1 kb (bases) 432 568 262 170 206 362
Base content (%) 43.2% 56.8%
16S rRNA gene (size: 1527 bases) GC AT G C A T
Base content (bases) 663 864 425 238 317 547
Base content per 1 kb (bases) 434 566 278 156 208 358
Base content (%) 43.4% 56.6%

ATP6 (size: 683 bases) GC AT G C A T
Base content (bases) 283 400 220 63 187 213
Base content per 1 kb (bases) 414 586 322 92 274 312
Base content (%) 41.4% 58.6%
ATP8 (size: 165 bases) GC AT G C A T
Base content (bases) 67 98 58 9 50 48
Base content per 1 kb (bases) 406 594 352 55 303 291
Base content (%) 40.6% 59.4%
COX1 (size: 1602 bases) GC AT G C A T
Base content (bases) 697 905 449 248 440 465
Base content per 1 kb (bases) 435 565 280 155 275 290
Base content (%) 43.5% 56.5%
COX2 (size: 690 bases) GC AT G C A T
Base content (bases) 281 409 194 87 176 233
Base content per 1 kb (bases) 407 593 281 126 255 338
Base content (%) 40.7% 59.3%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 346 438 241 105 208 230
Base content per 1 kb (bases) 441 559 307 134 265 293
Base content (%) 44.1% 55.9%
CYTB (size: 1133 bases) GC AT G C A T
Base content (bases) 461 672 328 133 327 345
Base content per 1 kb (bases) 407 593 289 117 289 305
Base content (%) 40.7% 59.3%
ND1 (size: 966 bases) GC AT G C A T
Base content (bases) 436 530 330 106 239 291
Base content per 1 kb (bases) 451 549 342 110 247 301
Base content (%) 45.1% 54.9%
ND2 (size: 1038 bases) GC AT G C A T
Base content (bases) 431 607 352 79 253 354
Base content per 1 kb (bases) 415 585 339 76 244 341
Base content (%) 41.5% 58.5%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 154 192 109 45 99 93
Base content per 1 kb (bases) 445 555 315 130 286 269
Base content (%) 44.5% 55.5%
ND4 (size: 1374 bases) GC AT G C A T
Base content (bases) 550 824 429 121 378 446
Base content per 1 kb (bases) 400 600 312 88 275 325
Base content (%) 40.0% 60.0%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 125 172 101 24 82 90
Base content per 1 kb (bases) 421 579 340 81 276 303
Base content (%) 42.1% 57.9%
ND5 (size: 1805 bases) GC AT G C A T
Base content (bases) 730 1075 546 184 480 595
Base content per 1 kb (bases) 404 596 302 102 266 330
Base content (%) 40.4% 59.6%
ND6 (size: 531 bases) GC AT G C A T
Base content (bases) 210 321 158 52 70 251
Base content per 1 kb (bases) 395 605 298 98 132 473
Base content (%) 39.5% 60.5%

ATP6 (size: 683 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.54%)
Alanine (Ala, A)
n = 16 (7.08%)
Serine (Ser, S)
n = 15 (6.64%)
Threonine (Thr, T)
n = 30 (13.27%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 7 (3.1%)
Leucine (Leu, L)
n = 61 (26.99%)
Isoleucine (Ile, I)
n = 17 (7.52%)
Methionine (Met, M)
n = 7 (3.1%)
Proline (Pro, P)
n = 16 (7.08%)
Phenylalanine (Phe, F)
n = 8 (3.54%)
Tyrosine (Tyr, Y)
n = 2 (0.88%)
Tryptophan (Trp, W)
n = 2 (0.88%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.77%)
Asparagine (Asn, N)
n = 12 (5.31%)
Glutamine (Gln, Q)
n = 8 (3.54%)
Histidine (His, H)
n = 3 (1.33%)
Lysine (Lys, K)
n = 6 (2.65%)
Arginine (Arg, R)
n = 4 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 4 6 14 11 23 3 10 8 0 0 6 1 0 2 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 6 7 3 0 2 1 5 0 1 2 12 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 13 2 3 2 4 1 3 2 1 1 0 0 2 10 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 0 0 1 6 0 2 0 2 0 0 0 0 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
36 82 77 32
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
19 72 36 100
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 66 99 54
ATP8 (size: 165 bases)
Amino acid sequence: MPQLNPNPWFLTMVITWLSLIFLLLAKLLLTSPHNLPPLISRTSPTPNWIWSWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 1 (1.85%)
Serine (Ser, S)
n = 5 (9.26%)
Threonine (Thr, T)
n = 6 (11.11%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.85%)
Leucine (Leu, L)
n = 12 (22.22%)
Isoleucine (Ile, I)
n = 4 (7.41%)
Methionine (Met, M)
n = 2 (3.7%)
Proline (Pro, P)
n = 8 (14.81%)
Phenylalanine (Phe, F)
n = 2 (3.7%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.26%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 4 (7.41%)
Glutamine (Gln, Q)
n = 1 (1.85%)
Histidine (His, H)
n = 1 (1.85%)
Lysine (Lys, K)
n = 1 (1.85%)
Arginine (Arg, R)
n = 1 (1.85%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 3 1 4 2 5 0 1 1 0 1 0 0 0 2 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 1 0 0 0 0 0 0 0 2 3 3 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 1 0 0 1 4 0 0 0 0 0 0 0 1 3 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 0 0 1 0 1 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
2 22 17 14
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 20 8 21
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
1 16 23 15
COX1 (size: 1602 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (8.82%)
Alanine (Ala, A)
n = 37 (6.94%)
Serine (Ser, S)
n = 38 (7.13%)
Threonine (Thr, T)
n = 37 (6.94%)
Cysteine (Cys, C)
n = 3 (0.56%)
Valine (Val, V)
n = 30 (5.63%)
Leucine (Leu, L)
n = 60 (11.26%)
Isoleucine (Ile, I)
n = 45 (8.44%)
Methionine (Met, M)
n = 36 (6.75%)
Proline (Pro, P)
n = 31 (5.82%)
Phenylalanine (Phe, F)
n = 38 (7.13%)
Tyrosine (Tyr, Y)
n = 21 (3.94%)
Tryptophan (Trp, W)
n = 20 (3.75%)
Aspartic acid (Asp, D)
n = 15 (2.81%)
Glutamic acid (Glu, E)
n = 8 (1.5%)
Asparagine (Asn, N)
n = 17 (3.19%)
Glutamine (Gln, Q)
n = 9 (1.69%)
Histidine (His, H)
n = 21 (3.94%)
Lysine (Lys, K)
n = 10 (1.88%)
Arginine (Arg, R)
n = 10 (1.88%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 28 33 10 15 20 2 13 9 0 6 10 13 1 15 23
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 2 3 20 14 0 2 13 24 8 8 8 13 2 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 18 1 7 10 14 0 1 6 9 12 5 0 7 10 9
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 8 0 4 11 9 1 1 2 7 0 1 0 0 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
137 118 153 126
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
88 136 101 209
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
23 195 211 105
COX2 (size: 690 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.93%)
Alanine (Ala, A)
n = 12 (5.24%)
Serine (Ser, S)
n = 17 (7.42%)
Threonine (Thr, T)
n = 26 (11.35%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 12 (5.24%)
Leucine (Leu, L)
n = 28 (12.23%)
Isoleucine (Ile, I)
n = 20 (8.73%)
Methionine (Met, M)
n = 10 (4.37%)
Proline (Pro, P)
n = 12 (5.24%)
Phenylalanine (Phe, F)
n = 8 (3.49%)
Tyrosine (Tyr, Y)
n = 11 (4.8%)
Tryptophan (Trp, W)
n = 5 (2.18%)
Aspartic acid (Asp, D)
n = 10 (4.37%)
Glutamic acid (Glu, E)
n = 10 (4.37%)
Asparagine (Asn, N)
n = 9 (3.93%)
Glutamine (Gln, Q)
n = 8 (3.49%)
Histidine (His, H)
n = 9 (3.93%)
Lysine (Lys, K)
n = 5 (2.18%)
Arginine (Arg, R)
n = 6 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 10 7 9 4 8 2 5 8 0 4 1 7 0 4 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 2 5 2 5 0 0 1 8 0 2 3 5 2 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 10 0 2 2 10 0 0 3 2 9 0 0 3 6 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 8 2 5 5 5 0 0 1 5 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
53 58 73 46
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 64 63 78
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 72 97 52
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.31%)
Alanine (Ala, A)
n = 14 (5.38%)
Serine (Ser, S)
n = 18 (6.92%)
Threonine (Thr, T)
n = 24 (9.23%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 12 (4.62%)
Leucine (Leu, L)
n = 34 (13.08%)
Isoleucine (Ile, I)
n = 15 (5.77%)
Methionine (Met, M)
n = 13 (5.0%)
Proline (Pro, P)
n = 14 (5.38%)
Phenylalanine (Phe, F)
n = 23 (8.85%)
Tyrosine (Tyr, Y)
n = 9 (3.46%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 4 (1.54%)
Glutamine (Gln, Q)
n = 10 (3.85%)
Histidine (His, H)
n = 18 (6.92%)
Lysine (Lys, K)
n = 4 (1.54%)
Arginine (Arg, R)
n = 4 (1.54%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 10 10 7 4 19 1 2 10 0 0 7 5 0 11 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 1 0 9 5 0 1 8 8 2 2 4 7 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 12 0 3 6 7 0 0 2 1 8 0 1 2 2 9
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 7 1 1 3 4 0 0 1 3 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
57 77 62 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 68 57 97
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 96 111 45
CYTB (size: 1133 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (6.91%)
Alanine (Ala, A)
n = 17 (4.52%)
Serine (Ser, S)
n = 20 (5.32%)
Threonine (Thr, T)
n = 41 (10.9%)
Cysteine (Cys, C)
n = 3 (0.8%)
Valine (Val, V)
n = 9 (2.39%)
Leucine (Leu, L)
n = 68 (18.09%)
Isoleucine (Ile, I)
n = 36 (9.57%)
Methionine (Met, M)
n = 15 (3.99%)
Proline (Pro, P)
n = 22 (5.85%)
Phenylalanine (Phe, F)
n = 23 (6.12%)
Tyrosine (Tyr, Y)
n = 11 (2.93%)
Tryptophan (Trp, W)
n = 12 (3.19%)
Aspartic acid (Asp, D)
n = 8 (2.13%)
Glutamic acid (Glu, E)
n = 5 (1.33%)
Asparagine (Asn, N)
n = 21 (5.59%)
Glutamine (Gln, Q)
n = 10 (2.66%)
Histidine (His, H)
n = 14 (3.72%)
Lysine (Lys, K)
n = 9 (2.39%)
Arginine (Arg, R)
n = 7 (1.86%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 21 12 9 17 29 2 8 8 2 1 1 5 2 13 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 2 6 4 7 0 3 8 12 3 3 6 11 2 15
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 13 0 3 5 12 0 0 0 4 7 2 3 9 12 10
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 5 0 1 7 8 1 2 1 4 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
65 110 122 80
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
48 100 78 151
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 118 144 95
ND1 (size: 966 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.61%)
Alanine (Ala, A)
n = 20 (6.23%)
Serine (Ser, S)
n = 27 (8.41%)
Threonine (Thr, T)
n = 29 (9.03%)
Cysteine (Cys, C)
n = 2 (0.62%)
Valine (Val, V)
n = 7 (2.18%)
Leucine (Leu, L)
n = 63 (19.63%)
Isoleucine (Ile, I)
n = 31 (9.66%)
Methionine (Met, M)
n = 16 (4.98%)
Proline (Pro, P)
n = 24 (7.48%)
Phenylalanine (Phe, F)
n = 14 (4.36%)
Tyrosine (Tyr, Y)
n = 8 (2.49%)
Tryptophan (Trp, W)
n = 8 (2.49%)
Aspartic acid (Asp, D)
n = 3 (0.93%)
Glutamic acid (Glu, E)
n = 10 (3.12%)
Asparagine (Asn, N)
n = 13 (4.05%)
Glutamine (Gln, Q)
n = 9 (2.8%)
Histidine (His, H)
n = 3 (0.93%)
Lysine (Lys, K)
n = 8 (2.49%)
Arginine (Arg, R)
n = 8 (2.49%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 25 15 7 23 23 1 9 9 0 1 3 3 0 7 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 2 3 7 9 1 2 2 11 3 3 8 13 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 8 0 3 11 11 0 0 2 4 4 1 0 3 10 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 8 2 0 3 7 1 1 4 3 0 0 0 1 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
58 98 99 67
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 98 55 131
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 134 137 41
ND2 (size: 1038 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.06%)
Alanine (Ala, A)
n = 21 (6.09%)
Serine (Ser, S)
n = 36 (10.43%)
Threonine (Thr, T)
n = 46 (13.33%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 3 (0.87%)
Leucine (Leu, L)
n = 63 (18.26%)
Isoleucine (Ile, I)
n = 42 (12.17%)
Methionine (Met, M)
n = 22 (6.38%)
Proline (Pro, P)
n = 20 (5.8%)
Phenylalanine (Phe, F)
n = 12 (3.48%)
Tyrosine (Tyr, Y)
n = 7 (2.03%)
Tryptophan (Trp, W)
n = 8 (2.32%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 14 (4.06%)
Glutamine (Gln, Q)
n = 10 (2.9%)
Histidine (His, H)
n = 8 (2.32%)
Lysine (Lys, K)
n = 10 (2.9%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 27 22 7 20 26 1 8 9 1 0 1 2 0 3 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
0 0 0 3 14 4 0 1 2 10 1 0 5 15 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
23 19 0 4 8 18 0 2 4 2 5 0 1 2 12 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 4 0 0 1 10 0 1 0 3 0 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
43 96 140 67
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 117 55 142
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 139 159 44
ND3 (size: 1038 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.06%)
Alanine (Ala, A)
n = 21 (6.09%)
Serine (Ser, S)
n = 36 (10.43%)
Threonine (Thr, T)
n = 46 (13.33%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 3 (0.87%)
Leucine (Leu, L)
n = 63 (18.26%)
Isoleucine (Ile, I)
n = 42 (12.17%)
Methionine (Met, M)
n = 22 (6.38%)
Proline (Pro, P)
n = 20 (5.8%)
Phenylalanine (Phe, F)
n = 12 (3.48%)
Tyrosine (Tyr, Y)
n = 7 (2.03%)
Tryptophan (Trp, W)
n = 8 (2.32%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 14 (4.06%)
Glutamine (Gln, Q)
n = 10 (2.9%)
Histidine (His, H)
n = 8 (2.32%)
Lysine (Lys, K)
n = 10 (2.9%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 27 22 7 20 26 1 8 9 1 0 1 2 0 3 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
0 0 0 3 14 4 0 1 2 10 1 0 5 15 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
23 19 0 4 8 18 0 2 4 2 5 0 1 2 12 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 4 0 0 1 10 0 1 0 3 0 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
43 96 140 67
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 117 55 142
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 139 159 44
ND4 (size: 1374 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (3.72%)
Alanine (Ala, A)
n = 26 (5.69%)
Serine (Ser, S)
n = 35 (7.66%)
Threonine (Thr, T)
n = 55 (12.04%)
Cysteine (Cys, C)
n = 4 (0.88%)
Valine (Val, V)
n = 6 (1.31%)
Leucine (Leu, L)
n = 105 (22.98%)
Isoleucine (Ile, I)
n = 43 (9.41%)
Methionine (Met, M)
n = 25 (5.47%)
Proline (Pro, P)
n = 30 (6.56%)
Phenylalanine (Phe, F)
n = 16 (3.5%)
Tyrosine (Tyr, Y)
n = 12 (2.63%)
Tryptophan (Trp, W)
n = 9 (1.97%)
Aspartic acid (Asp, D)
n = 2 (0.44%)
Glutamic acid (Glu, E)
n = 10 (2.19%)
Asparagine (Asn, N)
n = 19 (4.16%)
Glutamine (Gln, Q)
n = 10 (2.19%)
Histidine (His, H)
n = 10 (2.19%)
Lysine (Lys, K)
n = 14 (3.06%)
Arginine (Arg, R)
n = 9 (1.97%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 23 20 23 19 37 6 20 9 1 0 2 4 0 3 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 3 3 10 12 1 2 7 7 1 4 8 18 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 26 0 8 9 12 0 1 5 4 8 0 0 10 9 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 10 0 0 2 13 1 1 0 8 0 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
61 144 162 91
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
45 140 78 195
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 145 206 92
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 3 (3.06%)
Alanine (Ala, A)
n = 6 (6.12%)
Serine (Ser, S)
n = 9 (9.18%)
Threonine (Thr, T)
n = 16 (16.33%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 1 (1.02%)
Leucine (Leu, L)
n = 24 (24.49%)
Isoleucine (Ile, I)
n = 9 (9.18%)
Methionine (Met, M)
n = 4 (4.08%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 7 (7.14%)
Glutamine (Gln, Q)
n = 1 (1.02%)
Histidine (His, H)
n = 4 (4.08%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 6 4 2 8 9 1 4 1 0 0 0 1 0 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
0 2 1 1 1 4 0 0 2 1 0 0 0 2 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 5 0 3 3 1 0 0 2 0 0 0 0 2 5 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 0 1 0 0 0 0 1 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
13 29 38 19
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
10 31 16 42
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
1 41 36 21
ND5 (size: 1805 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (4.33%)
Alanine (Ala, A)
n = 46 (7.67%)
Serine (Ser, S)
n = 52 (8.67%)
Threonine (Thr, T)
n = 73 (12.17%)
Cysteine (Cys, C)
n = 4 (0.67%)
Valine (Val, V)
n = 9 (1.5%)
Leucine (Leu, L)
n = 89 (14.83%)
Isoleucine (Ile, I)
n = 63 (10.5%)
Methionine (Met, M)
n = 38 (6.33%)
Proline (Pro, P)
n = 29 (4.83%)
Phenylalanine (Phe, F)
n = 29 (4.83%)
Tyrosine (Tyr, Y)
n = 9 (1.5%)
Tryptophan (Trp, W)
n = 12 (2.0%)
Aspartic acid (Asp, D)
n = 10 (1.67%)
Glutamic acid (Glu, E)
n = 14 (2.33%)
Asparagine (Asn, N)
n = 34 (5.67%)
Glutamine (Gln, Q)
n = 16 (2.67%)
Histidine (His, H)
n = 18 (3.0%)
Lysine (Lys, K)
n = 21 (3.5%)
Arginine (Arg, R)
n = 9 (1.5%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
33 30 37 18 23 34 5 9 16 0 1 3 3 2 14 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 2 2 6 23 17 0 6 5 13 2 6 9 13 1 17
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
32 22 2 9 10 24 0 3 6 2 7 1 0 15 19 9
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 13 1 3 7 18 3 1 3 4 1 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
105 152 238 106
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
60 191 122 228
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 203 234 145
ND6 (size: 531 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (14.2%)
Alanine (Ala, A)
n = 6 (3.41%)
Serine (Ser, S)
n = 15 (8.52%)
Threonine (Thr, T)
n = 2 (1.14%)
Cysteine (Cys, C)
n = 5 (2.84%)
Valine (Val, V)
n = 30 (17.05%)
Leucine (Leu, L)
n = 36 (20.45%)
Isoleucine (Ile, I)
n = 4 (2.27%)
Methionine (Met, M)
n = 11 (6.25%)
Proline (Pro, P)
n = 4 (2.27%)
Phenylalanine (Phe, F)
n = 13 (7.39%)
Tyrosine (Tyr, Y)
n = 9 (5.11%)
Tryptophan (Trp, W)
n = 4 (2.27%)
Aspartic acid (Asp, D)
n = 3 (1.7%)
Glutamic acid (Glu, E)
n = 3 (1.7%)
Asparagine (Asn, N)
n = 2 (1.14%)
Glutamine (Gln, Q)
n = 1 (0.57%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 3 (1.7%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 1 4 5 1 0 0 10 1 0 18 1 3 8 12 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 5 0 4 1 1 0 10 1 7 7 1 1 0 2 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 0 4 5 3 2 1 0 9 0 3 20 2 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 2 3 0 0 0 2 0 0 1 0 0 0 1 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 14 20 76
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 26 19 94
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
53 12 31 81
Total protein-coding genes (size: 11414 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 217 (5.71%)
Alanine (Ala, A)
n = 230 (6.05%)
Serine (Ser, S)
n = 292 (7.68%)
Threonine (Thr, T)
n = 398 (10.47%)
Cysteine (Cys, C)
n = 29 (0.76%)
Valine (Val, V)
n = 129 (3.39%)
Leucine (Leu, L)
n = 669 (17.6%)
Isoleucine (Ile, I)
n = 335 (8.81%)
Methionine (Met, M)
n = 205 (5.39%)
Proline (Pro, P)
n = 221 (5.81%)
Phenylalanine (Phe, F)
n = 200 (5.26%)
Tyrosine (Tyr, Y)
n = 101 (2.66%)
Tryptophan (Trp, W)
n = 101 (2.66%)
Aspartic acid (Asp, D)
n = 61 (1.6%)
Glutamic acid (Glu, E)
n = 83 (2.18%)
Asparagine (Asn, N)
n = 159 (4.18%)
Glutamine (Gln, Q)
n = 95 (2.5%)
Histidine (His, H)
n = 111 (2.92%)
Lysine (Lys, K)
n = 90 (2.37%)
Arginine (Arg, R)
n = 68 (1.79%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
145 190 177 123 155 239 25 100 90 5 33 35 47 14 92 108
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
28 14 15 43 101 84 2 29 52 108 28 32 58 118 13 70
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
169 154 5 49 75 121 3 11 33 39 62 13 27 58 101 45
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
66 75 8 19 42 82 8 12 13 41 2 1 0 6 1 88
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
720 1037 1232 813
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
460 1097 707 1538
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
182 1275 1531 814

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.