Viewing data for Crotalus horridus


Scientific name Crotalus horridus
Common name Timber rattlesnake
Maximum lifespan 30.20 years (Crotalus horridus@AnAge)

Total mtDNA (size: 17260 bases) GC AT G C A T
Base content (bases) 7405 9855 5092 2313 4286 5569
Base content per 1 kb (bases) 429 571 295 134 248 323
Base content (%) 42.9% 57.1%
Total protein-coding genes (size: 11112 bases) GC AT G C A T
Base content (bases) 4850 6262 3490 1360 2699 3563
Base content per 1 kb (bases) 436 564 314 122 243 321
Base content (%) 43.6% 56.4%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1425 bases) GC AT G C A T
Base content (bases) 590 835 357 233 358 477
Base content per 1 kb (bases) 414 586 251 164 251 335
Base content (%) 41.4% 58.6%
Total rRNA-coding genes (size: 2211 bases) GC AT G C A T
Base content (bases) 941 1270 566 375 467 803
Base content per 1 kb (bases) 426 574 256 170 211 363
Base content (%) 42.6% 57.4%
12S rRNA gene: No data available for this section.
16S rRNA gene: No data available for this section.

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 271 410 204 67 181 229
Base content per 1 kb (bases) 398 602 300 98 266 336
Base content (%) 39.8% 60.2%
ATP8 (size: 165 bases) GC AT G C A T
Base content (bases) 60 105 51 9 34 71
Base content per 1 kb (bases) 364 636 309 55 206 430
Base content (%) 36.4% 63.6%
COX1 (size: 1602 bases) GC AT G C A T
Base content (bases) 724 878 458 266 431 447
Base content per 1 kb (bases) 452 548 286 166 269 279
Base content (%) 45.2% 54.8%
COX2 (size: 685 bases) GC AT G C A T
Base content (bases) 319 366 209 110 152 214
Base content per 1 kb (bases) 466 534 305 161 222 312
Base content (%) 46.6% 53.4%
COX3 (size: 782 bases) GC AT G C A T
Base content (bases) 342 440 224 118 197 243
Base content per 1 kb (bases) 437 563 286 151 252 311
Base content (%) 43.7% 56.3%
CYTB (size: 1079 bases) GC AT G C A T
Base content (bases) 468 611 345 123 303 308
Base content per 1 kb (bases) 434 566 320 114 281 285
Base content (%) 43.4% 56.6%
ND1 (size: 957 bases) GC AT G C A T
Base content (bases) 427 530 303 124 246 284
Base content per 1 kb (bases) 446 554 317 130 257 297
Base content (%) 44.6% 55.4%
ND2 (size: 1036 bases) GC AT G C A T
Base content (bases) 454 582 358 96 225 357
Base content per 1 kb (bases) 438 562 346 93 217 345
Base content (%) 43.8% 56.2%
ND3 (size: 334 bases) GC AT G C A T
Base content (bases) 144 190 103 41 82 108
Base content per 1 kb (bases) 431 569 308 123 246 323
Base content (%) 43.1% 56.9%
ND4 (size: 1221 bases) GC AT G C A T
Base content (bases) 550 671 404 146 291 380
Base content per 1 kb (bases) 450 550 331 120 238 311
Base content (%) 45.0% 55.0%
ND4L (size: 291 bases) GC AT G C A T
Base content (bases) 121 170 91 30 76 94
Base content per 1 kb (bases) 416 584 313 103 261 323
Base content (%) 41.6% 58.4%
ND5 (size: 1774 bases) GC AT G C A T
Base content (bases) 744 1030 552 192 415 615
Base content per 1 kb (bases) 419 581 311 108 234 347
Base content (%) 41.9% 58.1%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 230 292 191 39 69 223
Base content per 1 kb (bases) 441 559 366 75 132 427
Base content (%) 44.1% 55.9%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 7 (3.1%)
Alanine (Ala, A)
n = 15 (6.64%)
Serine (Ser, S)
n = 16 (7.08%)
Threonine (Thr, T)
n = 22 (9.73%)
Cysteine (Cys, C)
n = 1 (0.44%)
Valine (Val, V)
n = 6 (2.65%)
Leucine (Leu, L)
n = 51 (22.57%)
Isoleucine (Ile, I)
n = 19 (8.41%)
Methionine (Met, M)
n = 17 (7.52%)
Proline (Pro, P)
n = 16 (7.08%)
Phenylalanine (Phe, F)
n = 10 (4.42%)
Tyrosine (Tyr, Y)
n = 5 (2.21%)
Tryptophan (Trp, W)
n = 2 (0.88%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 6 (2.65%)
Asparagine (Asn, N)
n = 10 (4.42%)
Glutamine (Gln, Q)
n = 7 (3.1%)
Histidine (His, H)
n = 4 (1.77%)
Lysine (Lys, K)
n = 8 (3.54%)
Arginine (Arg, R)
n = 3 (1.33%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 13 14 6 5 23 6 11 6 1 0 0 6 0 5 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 0 2 11 2 0 1 1 4 1 0 7 8 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 9 0 3 3 4 0 3 3 5 0 0 0 3 7 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 6 0 0 1 7 1 0 1 2 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
35 70 82 40
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
19 63 42 103
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 71 105 38
ATP8 (size: 165 bases)
Amino acid sequence: MPQLDIVHILTIYLWTWLTLTLITLKIKTFTITNKPKNNHNQYRQPATPMLPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 1 (1.85%)
Serine (Ser, S)
n = 0 (0%)
Threonine (Thr, T)
n = 10 (18.52%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.85%)
Leucine (Leu, L)
n = 8 (14.81%)
Isoleucine (Ile, I)
n = 6 (11.11%)
Methionine (Met, M)
n = 2 (3.7%)
Proline (Pro, P)
n = 5 (9.26%)
Phenylalanine (Phe, F)
n = 1 (1.85%)
Tyrosine (Tyr, Y)
n = 2 (3.7%)
Tryptophan (Trp, W)
n = 3 (5.56%)
Aspartic acid (Asp, D)
n = 1 (1.85%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 4 (7.41%)
Glutamine (Gln, Q)
n = 3 (5.56%)
Histidine (His, H)
n = 2 (3.7%)
Lysine (Lys, K)
n = 4 (7.41%)
Arginine (Arg, R)
n = 1 (1.85%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 4 1 2 0 6 0 0 3 0 0 0 1 0 0 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 1 0 0 0 0 0 0 1 4 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 5 0 0 0 0 0 0 0 0 2 1 0 2 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 0 0 1 0 4 0 0 1 0 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
3 19 26 7
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
4 16 17 18
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 16 28 9
COX1 (size: 1602 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 45 (8.44%)
Alanine (Ala, A)
n = 35 (6.57%)
Serine (Ser, S)
n = 33 (6.19%)
Threonine (Thr, T)
n = 46 (8.63%)
Cysteine (Cys, C)
n = 4 (0.75%)
Valine (Val, V)
n = 27 (5.07%)
Leucine (Leu, L)
n = 62 (11.63%)
Isoleucine (Ile, I)
n = 46 (8.63%)
Methionine (Met, M)
n = 32 (6.0%)
Proline (Pro, P)
n = 34 (6.38%)
Phenylalanine (Phe, F)
n = 42 (7.88%)
Tyrosine (Tyr, Y)
n = 18 (3.38%)
Tryptophan (Trp, W)
n = 19 (3.56%)
Aspartic acid (Asp, D)
n = 14 (2.63%)
Glutamic acid (Glu, E)
n = 8 (1.5%)
Asparagine (Asn, N)
n = 18 (3.38%)
Glutamine (Gln, Q)
n = 9 (1.69%)
Histidine (His, H)
n = 19 (3.56%)
Lysine (Lys, K)
n = 13 (2.44%)
Arginine (Arg, R)
n = 9 (1.69%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 29 27 6 10 31 6 6 6 3 3 5 12 7 19 23
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 4 4 13 17 1 4 13 18 10 8 14 10 2 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 19 1 7 12 8 0 3 3 10 8 5 3 4 14 8
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 4 4 2 12 9 4 1 2 4 2 1 0 0 0 14
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
129 124 162 119
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
84 142 99 209
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
53 192 186 103
COX2 (size: 685 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 20 (8.81%)
Serine (Ser, S)
n = 17 (7.49%)
Threonine (Thr, T)
n = 18 (7.93%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 16 (7.05%)
Leucine (Leu, L)
n = 26 (11.45%)
Isoleucine (Ile, I)
n = 14 (6.17%)
Methionine (Met, M)
n = 12 (5.29%)
Proline (Pro, P)
n = 14 (6.17%)
Phenylalanine (Phe, F)
n = 7 (3.08%)
Tyrosine (Tyr, Y)
n = 9 (3.96%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 8 (3.52%)
Glutamic acid (Glu, E)
n = 16 (7.05%)
Asparagine (Asn, N)
n = 6 (2.64%)
Glutamine (Gln, Q)
n = 11 (4.85%)
Histidine (His, H)
n = 8 (3.52%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 7 (3.08%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 8 8 1 5 12 5 3 10 1 3 5 7 1 6 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 3 2 11 7 0 1 4 2 1 1 5 8 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 8 0 1 5 9 0 1 1 3 6 1 0 2 4 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 14 2 2 6 3 0 0 2 3 2 0 0 0 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 63 55 42
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 67 61 75
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 79 98 34
COX3 (size: 781 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.34%)
Alanine (Ala, A)
n = 13 (5.02%)
Serine (Ser, S)
n = 16 (6.18%)
Threonine (Thr, T)
n = 28 (10.81%)
Cysteine (Cys, C)
n = 1 (0.39%)
Valine (Val, V)
n = 17 (6.56%)
Leucine (Leu, L)
n = 35 (13.51%)
Isoleucine (Ile, I)
n = 16 (6.18%)
Methionine (Met, M)
n = 13 (5.02%)
Proline (Pro, P)
n = 11 (4.25%)
Phenylalanine (Phe, F)
n = 18 (6.95%)
Tyrosine (Tyr, Y)
n = 12 (4.63%)
Tryptophan (Trp, W)
n = 12 (4.63%)
Aspartic acid (Asp, D)
n = 5 (1.93%)
Glutamic acid (Glu, E)
n = 8 (3.09%)
Asparagine (Asn, N)
n = 5 (1.93%)
Glutamine (Gln, Q)
n = 6 (2.32%)
Histidine (His, H)
n = 15 (5.79%)
Lysine (Lys, K)
n = 5 (1.93%)
Arginine (Arg, R)
n = 5 (1.93%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 10 11 5 5 17 2 5 5 1 1 3 12 1 4 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 1 7 4 1 2 7 9 1 0 3 7 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 12 2 1 2 10 0 0 3 5 7 2 1 1 4 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 7 1 4 1 5 0 1 1 3 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
62 66 70 62
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
40 65 56 99
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 93 117 35
CYTB (size: 1077 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (5.31%)
Alanine (Ala, A)
n = 23 (6.42%)
Serine (Ser, S)
n = 25 (6.98%)
Threonine (Thr, T)
n = 36 (10.06%)
Cysteine (Cys, C)
n = 2 (0.56%)
Valine (Val, V)
n = 10 (2.79%)
Leucine (Leu, L)
n = 46 (12.85%)
Isoleucine (Ile, I)
n = 38 (10.61%)
Methionine (Met, M)
n = 17 (4.75%)
Proline (Pro, P)
n = 21 (5.87%)
Phenylalanine (Phe, F)
n = 32 (8.94%)
Tyrosine (Tyr, Y)
n = 15 (4.19%)
Tryptophan (Trp, W)
n = 12 (3.35%)
Aspartic acid (Asp, D)
n = 7 (1.96%)
Glutamic acid (Glu, E)
n = 6 (1.68%)
Asparagine (Asn, N)
n = 16 (4.47%)
Glutamine (Gln, Q)
n = 7 (1.96%)
Histidine (His, H)
n = 13 (3.63%)
Lysine (Lys, K)
n = 7 (1.96%)
Arginine (Arg, R)
n = 6 (1.68%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 22 16 4 12 19 2 5 7 0 2 4 3 1 12 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 2 5 11 7 0 2 9 5 3 2 11 7 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 15 1 9 7 7 1 0 1 1 14 2 4 4 12 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 5 1 2 5 6 1 0 0 6 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
65 84 115 95
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
40 104 72 143
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 157 119 65
ND1 (size: 957 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (5.03%)
Alanine (Ala, A)
n = 23 (7.23%)
Serine (Ser, S)
n = 29 (9.12%)
Threonine (Thr, T)
n = 25 (7.86%)
Cysteine (Cys, C)
n = 3 (0.94%)
Valine (Val, V)
n = 8 (2.52%)
Leucine (Leu, L)
n = 57 (17.92%)
Isoleucine (Ile, I)
n = 19 (5.97%)
Methionine (Met, M)
n = 24 (7.55%)
Proline (Pro, P)
n = 22 (6.92%)
Phenylalanine (Phe, F)
n = 18 (5.66%)
Tyrosine (Tyr, Y)
n = 10 (3.14%)
Tryptophan (Trp, W)
n = 8 (2.52%)
Aspartic acid (Asp, D)
n = 3 (0.94%)
Glutamic acid (Glu, E)
n = 11 (3.46%)
Asparagine (Asn, N)
n = 15 (4.72%)
Glutamine (Gln, Q)
n = 7 (2.2%)
Histidine (His, H)
n = 4 (1.26%)
Lysine (Lys, K)
n = 6 (1.89%)
Arginine (Arg, R)
n = 10 (3.14%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 12 22 6 9 25 5 11 6 1 0 2 5 1 5 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 3 6 11 6 0 0 7 6 3 2 10 9 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 12 0 3 12 10 4 0 0 2 8 2 1 3 12 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 9 2 1 2 5 1 0 3 6 1 0 1 0 0 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
61 88 90 80
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 99 56 126
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
25 116 138 40
ND2 (size: 1036 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (2.62%)
Alanine (Ala, A)
n = 34 (9.88%)
Serine (Ser, S)
n = 25 (7.27%)
Threonine (Thr, T)
n = 59 (17.15%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 6 (1.74%)
Leucine (Leu, L)
n = 59 (17.15%)
Isoleucine (Ile, I)
n = 29 (8.43%)
Methionine (Met, M)
n = 27 (7.85%)
Proline (Pro, P)
n = 21 (6.1%)
Phenylalanine (Phe, F)
n = 9 (2.62%)
Tyrosine (Tyr, Y)
n = 6 (1.74%)
Tryptophan (Trp, W)
n = 9 (2.62%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 6 (1.74%)
Asparagine (Asn, N)
n = 14 (4.07%)
Glutamine (Gln, Q)
n = 6 (1.74%)
Histidine (His, H)
n = 8 (2.33%)
Lysine (Lys, K)
n = 12 (3.49%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 21 26 4 15 27 3 10 4 2 2 1 2 1 3 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 2 19 12 1 0 1 8 0 1 10 10 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
27 25 1 4 8 9 0 0 4 2 4 1 0 4 10 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 5 1 0 1 11 1 1 0 2 1 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
56 88 145 56
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
27 135 53 130
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 135 159 38
ND3 (size: 1036 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (2.62%)
Alanine (Ala, A)
n = 34 (9.88%)
Serine (Ser, S)
n = 25 (7.27%)
Threonine (Thr, T)
n = 59 (17.15%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 6 (1.74%)
Leucine (Leu, L)
n = 59 (17.15%)
Isoleucine (Ile, I)
n = 29 (8.43%)
Methionine (Met, M)
n = 27 (7.85%)
Proline (Pro, P)
n = 21 (6.1%)
Phenylalanine (Phe, F)
n = 9 (2.62%)
Tyrosine (Tyr, Y)
n = 6 (1.74%)
Tryptophan (Trp, W)
n = 9 (2.62%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 6 (1.74%)
Asparagine (Asn, N)
n = 14 (4.07%)
Glutamine (Gln, Q)
n = 6 (1.74%)
Histidine (His, H)
n = 8 (2.33%)
Lysine (Lys, K)
n = 12 (3.49%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 21 26 4 15 27 3 10 4 2 2 1 2 1 3 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 2 19 12 1 0 1 8 0 1 10 10 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
27 25 1 4 8 9 0 0 4 2 4 1 0 4 10 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 5 1 0 1 11 1 1 0 2 1 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
56 88 145 56
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
27 135 53 130
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 135 159 38
ND4 (size: 1221 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (4.19%)
Alanine (Ala, A)
n = 33 (8.13%)
Serine (Ser, S)
n = 28 (6.9%)
Threonine (Thr, T)
n = 47 (11.58%)
Cysteine (Cys, C)
n = 4 (0.99%)
Valine (Val, V)
n = 6 (1.48%)
Leucine (Leu, L)
n = 81 (19.95%)
Isoleucine (Ile, I)
n = 39 (9.61%)
Methionine (Met, M)
n = 28 (6.9%)
Proline (Pro, P)
n = 24 (5.91%)
Phenylalanine (Phe, F)
n = 15 (3.69%)
Tyrosine (Tyr, Y)
n = 11 (2.71%)
Tryptophan (Trp, W)
n = 10 (2.46%)
Aspartic acid (Asp, D)
n = 2 (0.49%)
Glutamic acid (Glu, E)
n = 8 (1.97%)
Asparagine (Asn, N)
n = 14 (3.45%)
Glutamine (Gln, Q)
n = 11 (2.71%)
Histidine (His, H)
n = 9 (2.22%)
Lysine (Lys, K)
n = 9 (2.22%)
Arginine (Arg, R)
n = 10 (2.46%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 22 20 10 18 39 9 3 10 1 0 1 4 1 8 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 1 3 1 18 13 1 0 6 7 4 4 9 11 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 25 1 4 7 10 2 1 4 3 8 2 2 1 13 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 7 1 0 2 8 1 0 2 8 0 0 0 0 1 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 130 142 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
46 127 65 169
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
34 147 173 53
ND4L (size: 291 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 3 (3.13%)
Alanine (Ala, A)
n = 6 (6.25%)
Serine (Ser, S)
n = 7 (7.29%)
Threonine (Thr, T)
n = 11 (11.46%)
Cysteine (Cys, C)
n = 2 (2.08%)
Valine (Val, V)
n = 8 (8.33%)
Leucine (Leu, L)
n = 23 (23.96%)
Isoleucine (Ile, I)
n = 6 (6.25%)
Methionine (Met, M)
n = 9 (9.38%)
Proline (Pro, P)
n = 2 (2.08%)
Phenylalanine (Phe, F)
n = 3 (3.13%)
Tyrosine (Tyr, Y)
n = 1 (1.04%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.04%)
Glutamic acid (Glu, E)
n = 2 (2.08%)
Asparagine (Asn, N)
n = 3 (3.13%)
Glutamine (Gln, Q)
n = 2 (2.08%)
Histidine (His, H)
n = 3 (3.13%)
Lysine (Lys, K)
n = 3 (3.13%)
Arginine (Arg, R)
n = 1 (1.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 5 8 4 6 10 0 3 2 0 0 5 3 0 1 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 2 1 1 4 0 0 2 1 0 0 0 1 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 2 0 2 0 3 0 0 2 0 1 0 0 0 3 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 0 1 3 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
20 28 34 15
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
8 24 16 49
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 39 44 12
ND5 (size: 1773 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 23 (3.9%)
Alanine (Ala, A)
n = 40 (6.78%)
Serine (Ser, S)
n = 45 (7.63%)
Threonine (Thr, T)
n = 84 (14.24%)
Cysteine (Cys, C)
n = 3 (0.51%)
Valine (Val, V)
n = 17 (2.88%)
Leucine (Leu, L)
n = 84 (14.24%)
Isoleucine (Ile, I)
n = 56 (9.49%)
Methionine (Met, M)
n = 48 (8.14%)
Proline (Pro, P)
n = 27 (4.58%)
Phenylalanine (Phe, F)
n = 27 (4.58%)
Tyrosine (Tyr, Y)
n = 12 (2.03%)
Tryptophan (Trp, W)
n = 9 (1.53%)
Aspartic acid (Asp, D)
n = 9 (1.53%)
Glutamic acid (Glu, E)
n = 10 (1.69%)
Asparagine (Asn, N)
n = 31 (5.25%)
Glutamine (Gln, Q)
n = 22 (3.73%)
Histidine (His, H)
n = 11 (1.86%)
Lysine (Lys, K)
n = 24 (4.07%)
Arginine (Arg, R)
n = 8 (1.36%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 40 39 15 15 40 4 9 19 3 4 2 9 2 6 21
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 0 3 6 15 18 1 2 11 5 5 2 15 9 1 13
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
33 35 3 5 13 13 2 4 8 4 8 0 1 4 27 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 8 2 3 6 19 5 0 2 6 0 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
99 142 255 95
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
55 184 120 232
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
38 226 239 88
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 29 (16.76%)
Alanine (Ala, A)
n = 7 (4.05%)
Serine (Ser, S)
n = 9 (5.2%)
Threonine (Thr, T)
n = 2 (1.16%)
Cysteine (Cys, C)
n = 7 (4.05%)
Valine (Val, V)
n = 37 (21.39%)
Leucine (Leu, L)
n = 26 (15.03%)
Isoleucine (Ile, I)
n = 6 (3.47%)
Methionine (Met, M)
n = 9 (5.2%)
Proline (Pro, P)
n = 1 (0.58%)
Phenylalanine (Phe, F)
n = 11 (6.36%)
Tyrosine (Tyr, Y)
n = 10 (5.78%)
Tryptophan (Trp, W)
n = 5 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.58%)
Glutamic acid (Glu, E)
n = 6 (3.47%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 2 (1.16%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 1 (0.58%)
Arginine (Arg, R)
n = 3 (1.73%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 1 5 3 0 0 3 9 2 0 15 2 3 17 11 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 7 0 2 1 2 2 11 2 1 15 1 0 0 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 0 4 2 0 0 3 0 8 2 3 11 1 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 5 0 1 0 1 2 0 0 1 0 1 0 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
80 12 23 59
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
48 16 21 89
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
63 11 25 75
Total protein-coding genes (size: 11125 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 201 (5.42%)
Alanine (Ala, A)
n = 257 (6.93%)
Serine (Ser, S)
n = 256 (6.91%)
Threonine (Thr, T)
n = 400 (10.79%)
Cysteine (Cys, C)
n = 32 (0.86%)
Valine (Val, V)
n = 161 (4.34%)
Leucine (Leu, L)
n = 580 (15.65%)
Isoleucine (Ile, I)
n = 306 (8.26%)
Methionine (Met, M)
n = 244 (6.58%)
Proline (Pro, P)
n = 206 (5.56%)
Phenylalanine (Phe, F)
n = 198 (5.34%)
Tyrosine (Tyr, Y)
n = 114 (3.08%)
Tryptophan (Trp, W)
n = 97 (2.62%)
Aspartic acid (Asp, D)
n = 56 (1.51%)
Glutamic acid (Glu, E)
n = 92 (2.48%)
Asparagine (Asn, N)
n = 141 (3.8%)
Glutamine (Gln, Q)
n = 95 (2.56%)
Histidine (His, H)
n = 96 (2.59%)
Lysine (Lys, K)
n = 98 (2.64%)
Arginine (Arg, R)
n = 68 (1.83%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
110 196 203 70 103 260 47 77 82 13 30 31 68 32 82 116
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
41 9 23 33 121 96 7 23 67 68 43 21 89 88 8 50
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
167 174 9 44 73 83 9 16 31 43 71 20 23 30 111 25
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
71 72 20 16 40 83 15 5 14 42 7 1 2 5 1 77
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
767 945 1239 756
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
448 1072 698 1489
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
297 1324 1479 607

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.