Viewing data for Carpiodes carpio


Scientific name Carpiodes carpio
Common name River carpsucker
Maximum lifespan 10.00 years (Carpiodes carpio@AnAge)

Total mtDNA (size: 16611 bases) GC AT G C A T
Base content (bases) 7616 8995 4559 3057 4245 4750
Base content per 1 kb (bases) 458 542 274 184 256 286
Base content (%) 45.8% 54.2%
Total protein-coding genes (size: 11413 bases) GC AT G C A T
Base content (bases) 5281 6132 3306 1975 3026 3106
Base content per 1 kb (bases) 463 537 290 173 265 272
Base content (%) 46.3% 53.7%
D-loop (size: 929 bases) GC AT G C A T
Base content (bases) 346 583 194 152 284 299
Base content per 1 kb (bases) 372 628 209 164 306 322
Base content (%) 37.2% 62.8%
Total tRNA-coding genes (size: 1563 bases) GC AT G C A T
Base content (bases) 710 853 387 323 392 461
Base content per 1 kb (bases) 454 546 248 207 251 295
Base content (%) 45.4% 54.6%
Total rRNA-coding genes (size: 2641 bases) GC AT G C A T
Base content (bases) 1245 1396 649 596 528 868
Base content per 1 kb (bases) 471 529 246 226 200 329
Base content (%) 47.1% 52.9%
12S rRNA gene (size: 952 bases) GC AT G C A T
Base content (bases) 468 484 249 219 192 292
Base content per 1 kb (bases) 492 508 262 230 202 307
Base content (%) 49.2% 50.8%
16S rRNA gene (size: 1689 bases) GC AT G C A T
Base content (bases) 777 912 400 377 336 576
Base content per 1 kb (bases) 460 540 237 223 199 341
Base content (%) 46.0% 54.0%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 288 396 183 105 207 189
Base content per 1 kb (bases) 421 579 268 154 303 276
Base content (%) 42.1% 57.9%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 70 98 46 24 44 54
Base content per 1 kb (bases) 417 583 274 143 262 321
Base content (%) 41.7% 58.3%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 707 844 417 290 449 395
Base content per 1 kb (bases) 456 544 269 187 289 255
Base content (%) 45.6% 54.4%
COX2 (size: 691 bases) GC AT G C A T
Base content (bases) 297 394 174 123 196 198
Base content per 1 kb (bases) 430 570 252 178 284 287
Base content (%) 43.0% 57.0%
COX3 (size: 786 bases) GC AT G C A T
Base content (bases) 374 412 231 143 210 202
Base content per 1 kb (bases) 476 524 294 182 267 257
Base content (%) 47.6% 52.4%
CYTB (size: 1141 bases) GC AT G C A T
Base content (bases) 523 618 329 194 318 300
Base content per 1 kb (bases) 458 542 288 170 279 263
Base content (%) 45.8% 54.2%
ND1 (size: 975 bases) GC AT G C A T
Base content (bases) 469 506 291 178 248 258
Base content per 1 kb (bases) 481 519 298 183 254 265
Base content (%) 48.1% 51.9%
ND2 (size: 1047 bases) GC AT G C A T
Base content (bases) 521 526 343 178 250 276
Base content per 1 kb (bases) 498 502 328 170 239 264
Base content (%) 49.8% 50.2%
ND3 (size: 351 bases) GC AT G C A T
Base content (bases) 166 185 101 65 103 82
Base content per 1 kb (bases) 473 527 288 185 293 234
Base content (%) 47.3% 52.7%
ND4 (size: 1383 bases) GC AT G C A T
Base content (bases) 645 738 405 240 354 384
Base content per 1 kb (bases) 466 534 293 174 256 278
Base content (%) 46.6% 53.4%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 142 155 87 55 84 71
Base content per 1 kb (bases) 478 522 293 185 283 239
Base content (%) 47.8% 52.2%
ND5 (size: 1839 bases) GC AT G C A T
Base content (bases) 823 1016 534 289 497 519
Base content per 1 kb (bases) 448 552 290 157 270 282
Base content (%) 44.8% 55.2%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 261 261 167 94 72 189
Base content per 1 kb (bases) 500 500 320 180 138 362
Base content (%) 50.0% 50.0%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.85%)
Alanine (Ala, A)
n = 19 (8.37%)
Serine (Ser, S)
n = 9 (3.96%)
Threonine (Thr, T)
n = 19 (8.37%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 18 (7.93%)
Leucine (Leu, L)
n = 47 (20.7%)
Isoleucine (Ile, I)
n = 23 (10.13%)
Methionine (Met, M)
n = 10 (4.41%)
Proline (Pro, P)
n = 18 (7.93%)
Phenylalanine (Phe, F)
n = 11 (4.85%)
Tyrosine (Tyr, Y)
n = 5 (2.2%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 9 (3.96%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 1 (0.44%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 6 4 8 7 17 5 10 7 1 3 2 11 2 9 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 0 5 6 7 1 2 2 4 3 3 3 10 2 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 6 2 1 2 1 0 1 4 3 2 1 0 4 5 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 2 1 0 1 0 0 1 5 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
53 72 67 36
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
27 60 32 109
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
25 51 90 62
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPAPWFAILVFSWVIFLTVIPTKVLNHVSPNEPTPMSAEKHKTESWDWPWQ*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 3 (5.45%)
Serine (Ser, S)
n = 4 (7.27%)
Threonine (Thr, T)
n = 4 (7.27%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 5 (9.09%)
Leucine (Leu, L)
n = 4 (7.27%)
Isoleucine (Ile, I)
n = 3 (5.45%)
Methionine (Met, M)
n = 2 (3.64%)
Proline (Pro, P)
n = 8 (14.55%)
Phenylalanine (Phe, F)
n = 3 (5.45%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 1 (1.82%)
Glutamic acid (Glu, E)
n = 3 (5.45%)
Asparagine (Asn, N)
n = 3 (5.45%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 2 (3.64%)
Lysine (Lys, K)
n = 3 (5.45%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 1 0 0 1 1 0 2 2 0 1 1 3 0 2 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 1 1 1 0 0 0 0 0 1 4 2 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 1 0 0 1 2 0 0 1 0 0 1 0 2 1 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 1 2 0 1 3 0 0 0 0 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
12 14 16 14
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 18 15 17
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 14 23 13
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.11%)
Alanine (Ala, A)
n = 48 (9.3%)
Serine (Ser, S)
n = 31 (6.01%)
Threonine (Thr, T)
n = 35 (6.78%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 43 (8.33%)
Leucine (Leu, L)
n = 62 (12.02%)
Isoleucine (Ile, I)
n = 37 (7.17%)
Methionine (Met, M)
n = 24 (4.65%)
Proline (Pro, P)
n = 28 (5.43%)
Phenylalanine (Phe, F)
n = 42 (8.14%)
Tyrosine (Tyr, Y)
n = 18 (3.49%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 14 (2.71%)
Glutamic acid (Glu, E)
n = 11 (2.13%)
Asparagine (Asn, N)
n = 15 (2.91%)
Glutamine (Gln, Q)
n = 8 (1.55%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 8 (1.55%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
25 12 8 13 12 16 9 11 8 0 9 11 17 6 15 27
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
16 1 0 9 24 14 1 10 6 21 10 7 12 8 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 22 0 8 4 13 1 1 4 10 8 1 1 5 10 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
16 8 3 2 12 8 0 1 1 6 0 0 0 1 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
163 113 124 117
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
78 137 94 208
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
49 167 177 124
COX2 (size: 691 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.93%)
Alanine (Ala, A)
n = 17 (7.42%)
Serine (Ser, S)
n = 16 (6.99%)
Threonine (Thr, T)
n = 10 (4.37%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 20 (8.73%)
Leucine (Leu, L)
n = 28 (12.23%)
Isoleucine (Ile, I)
n = 18 (7.86%)
Methionine (Met, M)
n = 12 (5.24%)
Proline (Pro, P)
n = 14 (6.11%)
Phenylalanine (Phe, F)
n = 9 (3.93%)
Tyrosine (Tyr, Y)
n = 9 (3.93%)
Tryptophan (Trp, W)
n = 5 (2.18%)
Aspartic acid (Asp, D)
n = 12 (5.24%)
Glutamic acid (Glu, E)
n = 15 (6.55%)
Asparagine (Asn, N)
n = 6 (2.62%)
Glutamine (Gln, Q)
n = 8 (3.49%)
Histidine (His, H)
n = 10 (4.37%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 6 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 3 8 7 1 6 5 8 6 2 5 3 9 3 2 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 1 4 7 4 2 1 1 6 1 2 6 6 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 2 0 4 3 5 1 0 3 3 6 1 1 2 4 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 11 4 3 9 3 1 2 1 3 0 0 0 0 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
73 57 53 47
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 54 64 87
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
25 63 81 61
COX3 (size: 786 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (8.05%)
Alanine (Ala, A)
n = 23 (8.81%)
Serine (Ser, S)
n = 14 (5.36%)
Threonine (Thr, T)
n = 24 (9.2%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 17 (6.51%)
Leucine (Leu, L)
n = 33 (12.64%)
Isoleucine (Ile, I)
n = 14 (5.36%)
Methionine (Met, M)
n = 7 (2.68%)
Proline (Pro, P)
n = 12 (4.6%)
Phenylalanine (Phe, F)
n = 22 (8.43%)
Tyrosine (Tyr, Y)
n = 12 (4.6%)
Tryptophan (Trp, W)
n = 12 (4.6%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 10 (3.83%)
Asparagine (Asn, N)
n = 1 (0.38%)
Glutamine (Gln, Q)
n = 9 (3.45%)
Histidine (His, H)
n = 16 (6.13%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 8 2 10 4 7 6 5 9 0 4 4 8 1 5 17
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 1 5 8 10 0 1 6 12 2 1 6 5 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 11 3 1 5 4 1 0 3 4 8 2 1 1 0 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 8 2 2 3 1 1 2 1 2 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
76 69 51 66
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 70 56 93
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 92 95 51
CYTB (size: 1141 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (6.6%)
Alanine (Ala, A)
n = 34 (8.97%)
Serine (Ser, S)
n = 24 (6.33%)
Threonine (Thr, T)
n = 22 (5.8%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 25 (6.6%)
Leucine (Leu, L)
n = 58 (15.3%)
Isoleucine (Ile, I)
n = 30 (7.92%)
Methionine (Met, M)
n = 11 (2.9%)
Proline (Pro, P)
n = 21 (5.54%)
Phenylalanine (Phe, F)
n = 30 (7.92%)
Tyrosine (Tyr, Y)
n = 14 (3.69%)
Tryptophan (Trp, W)
n = 13 (3.43%)
Aspartic acid (Asp, D)
n = 10 (2.64%)
Glutamic acid (Glu, E)
n = 8 (2.11%)
Asparagine (Asn, N)
n = 17 (4.49%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 13 5 7 12 22 11 4 6 0 6 7 8 4 10 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 2 2 12 18 2 4 4 11 6 3 6 11 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 9 2 4 8 8 2 1 1 5 9 1 2 6 11 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 5 3 1 9 8 1 1 1 6 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
102 99 91 88
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
51 99 76 154
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
41 131 133 75
ND1 (size: 975 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.56%)
Alanine (Ala, A)
n = 37 (11.42%)
Serine (Ser, S)
n = 21 (6.48%)
Threonine (Thr, T)
n = 16 (4.94%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 21 (6.48%)
Leucine (Leu, L)
n = 58 (17.9%)
Isoleucine (Ile, I)
n = 23 (7.1%)
Methionine (Met, M)
n = 15 (4.63%)
Proline (Pro, P)
n = 24 (7.41%)
Phenylalanine (Phe, F)
n = 17 (5.25%)
Tyrosine (Tyr, Y)
n = 13 (4.01%)
Tryptophan (Trp, W)
n = 8 (2.47%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.4%)
Asparagine (Asn, N)
n = 12 (3.7%)
Glutamine (Gln, Q)
n = 7 (2.16%)
Histidine (His, H)
n = 4 (1.23%)
Lysine (Lys, K)
n = 7 (2.16%)
Arginine (Arg, R)
n = 8 (2.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 13 8 3 11 25 13 5 4 3 3 6 11 1 6 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 0 5 11 16 5 1 3 10 4 2 10 9 3 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 5 1 3 6 7 2 1 2 7 6 1 1 2 10 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 5 6 3 1 7 0 1 1 3 3 0 0 1 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
91 95 76 63
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 95 59 134
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
50 101 123 51
ND2 (size: 1047 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.17%)
Alanine (Ala, A)
n = 44 (12.64%)
Serine (Ser, S)
n = 23 (6.61%)
Threonine (Thr, T)
n = 42 (12.07%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 10 (2.87%)
Leucine (Leu, L)
n = 73 (20.98%)
Isoleucine (Ile, I)
n = 23 (6.61%)
Methionine (Met, M)
n = 17 (4.89%)
Proline (Pro, P)
n = 20 (5.75%)
Phenylalanine (Phe, F)
n = 9 (2.59%)
Tyrosine (Tyr, Y)
n = 8 (2.3%)
Tryptophan (Trp, W)
n = 11 (3.16%)
Aspartic acid (Asp, D)
n = 4 (1.15%)
Glutamic acid (Glu, E)
n = 5 (1.44%)
Asparagine (Asn, N)
n = 7 (2.01%)
Glutamine (Gln, Q)
n = 13 (3.74%)
Histidine (His, H)
n = 7 (2.01%)
Lysine (Lys, K)
n = 9 (2.59%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 8 11 11 17 18 14 8 7 6 3 4 3 0 3 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 0 5 21 14 4 0 5 10 3 1 8 9 2 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 13 4 5 3 6 2 1 6 3 5 5 5 4 3 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 4 1 0 4 6 3 1 1 2 0 0 0 0 1 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
81 104 105 59
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
41 122 54 132
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
56 117 117 59
ND3 (size: 1047 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.17%)
Alanine (Ala, A)
n = 44 (12.64%)
Serine (Ser, S)
n = 23 (6.61%)
Threonine (Thr, T)
n = 42 (12.07%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 10 (2.87%)
Leucine (Leu, L)
n = 73 (20.98%)
Isoleucine (Ile, I)
n = 23 (6.61%)
Methionine (Met, M)
n = 17 (4.89%)
Proline (Pro, P)
n = 20 (5.75%)
Phenylalanine (Phe, F)
n = 9 (2.59%)
Tyrosine (Tyr, Y)
n = 8 (2.3%)
Tryptophan (Trp, W)
n = 11 (3.16%)
Aspartic acid (Asp, D)
n = 4 (1.15%)
Glutamic acid (Glu, E)
n = 5 (1.44%)
Asparagine (Asn, N)
n = 7 (2.01%)
Glutamine (Gln, Q)
n = 13 (3.74%)
Histidine (His, H)
n = 7 (2.01%)
Lysine (Lys, K)
n = 9 (2.59%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 8 11 11 17 18 14 8 7 6 3 4 3 0 3 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 0 5 21 14 4 0 5 10 3 1 8 9 2 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 13 4 5 3 6 2 1 6 3 5 5 5 4 3 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 4 1 0 4 6 3 1 1 2 0 0 0 0 1 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
81 104 105 59
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
41 122 54 132
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
56 117 117 59
ND4 (size: 1383 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 29 (6.3%)
Alanine (Ala, A)
n = 36 (7.83%)
Serine (Ser, S)
n = 30 (6.52%)
Threonine (Thr, T)
n = 41 (8.91%)
Cysteine (Cys, C)
n = 5 (1.09%)
Valine (Val, V)
n = 18 (3.91%)
Leucine (Leu, L)
n = 85 (18.48%)
Isoleucine (Ile, I)
n = 39 (8.48%)
Methionine (Met, M)
n = 29 (6.3%)
Proline (Pro, P)
n = 28 (6.09%)
Phenylalanine (Phe, F)
n = 17 (3.7%)
Tyrosine (Tyr, Y)
n = 14 (3.04%)
Tryptophan (Trp, W)
n = 19 (4.13%)
Aspartic acid (Asp, D)
n = 3 (0.65%)
Glutamic acid (Glu, E)
n = 12 (2.61%)
Asparagine (Asn, N)
n = 10 (2.17%)
Glutamine (Gln, Q)
n = 12 (2.61%)
Histidine (His, H)
n = 12 (2.61%)
Lysine (Lys, K)
n = 10 (2.17%)
Arginine (Arg, R)
n = 11 (2.39%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 20 15 10 17 27 9 15 7 5 2 6 7 3 4 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
14 3 2 3 18 12 3 1 10 13 5 1 8 15 4 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 17 6 6 6 11 0 1 6 4 10 4 7 1 9 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 9 3 0 3 7 3 1 2 4 4 0 0 0 1 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
98 126 136 101
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
71 128 74 188
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
71 151 174 65
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 6 (6.12%)
Alanine (Ala, A)
n = 15 (15.31%)
Serine (Ser, S)
n = 9 (9.18%)
Threonine (Thr, T)
n = 6 (6.12%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 3 (3.06%)
Leucine (Leu, L)
n = 23 (23.47%)
Isoleucine (Ile, I)
n = 1 (1.02%)
Methionine (Met, M)
n = 5 (5.1%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 8 (8.16%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 3 (3.06%)
Histidine (His, H)
n = 4 (4.08%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 3 (3.06%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 0 3 1 5 7 1 7 3 0 2 0 1 0 5 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 3 2 7 5 1 1 1 3 1 0 0 2 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 3 1 1 2 2 1 1 2 0 0 1 2 0 2 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 2 1 0 1 0 0 0 2 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
28 26 17 28
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
16 29 14 40
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 32 40 16
ND5 (size: 1839 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 31 (5.07%)
Alanine (Ala, A)
n = 55 (8.99%)
Serine (Ser, S)
n = 42 (6.86%)
Threonine (Thr, T)
n = 57 (9.31%)
Cysteine (Cys, C)
n = 6 (0.98%)
Valine (Val, V)
n = 31 (5.07%)
Leucine (Leu, L)
n = 94 (15.36%)
Isoleucine (Ile, I)
n = 51 (8.33%)
Methionine (Met, M)
n = 29 (4.74%)
Proline (Pro, P)
n = 30 (4.9%)
Phenylalanine (Phe, F)
n = 40 (6.54%)
Tyrosine (Tyr, Y)
n = 12 (1.96%)
Tryptophan (Trp, W)
n = 14 (2.29%)
Aspartic acid (Asp, D)
n = 15 (2.45%)
Glutamic acid (Glu, E)
n = 12 (1.96%)
Asparagine (Asn, N)
n = 29 (4.74%)
Glutamine (Gln, Q)
n = 19 (3.1%)
Histidine (His, H)
n = 15 (2.45%)
Lysine (Lys, K)
n = 20 (3.27%)
Arginine (Arg, R)
n = 10 (1.63%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
26 25 13 17 14 32 10 14 16 3 7 13 11 0 11 29
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
16 3 3 10 28 16 1 3 9 10 9 7 12 9 2 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 23 6 7 8 13 1 1 12 4 8 4 7 13 16 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 7 5 6 9 15 5 0 1 7 2 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
144 147 199 123
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
74 171 123 245
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
71 216 197 129
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (14.45%)
Alanine (Ala, A)
n = 20 (11.56%)
Serine (Ser, S)
n = 13 (7.51%)
Threonine (Thr, T)
n = 5 (2.89%)
Cysteine (Cys, C)
n = 2 (1.16%)
Valine (Val, V)
n = 22 (12.72%)
Leucine (Leu, L)
n = 34 (19.65%)
Isoleucine (Ile, I)
n = 6 (3.47%)
Methionine (Met, M)
n = 6 (3.47%)
Proline (Pro, P)
n = 4 (2.31%)
Phenylalanine (Phe, F)
n = 7 (4.05%)
Tyrosine (Tyr, Y)
n = 8 (4.62%)
Tryptophan (Trp, W)
n = 5 (2.89%)
Aspartic acid (Asp, D)
n = 3 (1.73%)
Glutamic acid (Glu, E)
n = 5 (2.89%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 1 (0.58%)
Lysine (Lys, K)
n = 1 (0.58%)
Arginine (Arg, R)
n = 5 (2.89%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 0 2 7 2 3 7 7 0 0 8 2 5 7 7 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 2 0 11 3 4 2 4 5 3 13 3 0 0 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 0 0 4 4 1 1 1 2 3 5 4 8 0 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 1 4 3 0 1 0 3 0 1 1 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
75 29 22 48
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
40 39 20 75
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
52 26 30 66
Total protein-coding genes (size: 11435 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 247 (6.48%)
Alanine (Ala, A)
n = 360 (9.45%)
Serine (Ser, S)
n = 243 (6.38%)
Threonine (Thr, T)
n = 288 (7.56%)
Cysteine (Cys, C)
n = 26 (0.68%)
Valine (Val, V)
n = 236 (6.19%)
Leucine (Leu, L)
n = 625 (16.4%)
Isoleucine (Ile, I)
n = 278 (7.3%)
Methionine (Met, M)
n = 170 (4.46%)
Proline (Pro, P)
n = 217 (5.7%)
Phenylalanine (Phe, F)
n = 224 (5.88%)
Tyrosine (Tyr, Y)
n = 115 (3.02%)
Tryptophan (Trp, W)
n = 120 (3.15%)
Aspartic acid (Asp, D)
n = 77 (2.02%)
Glutamic acid (Glu, E)
n = 105 (2.76%)
Asparagine (Asn, N)
n = 114 (2.99%)
Glutamine (Gln, Q)
n = 98 (2.57%)
Histidine (His, H)
n = 106 (2.78%)
Lysine (Lys, K)
n = 75 (1.97%)
Arginine (Arg, R)
n = 76 (1.99%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
165 113 79 96 110 187 95 101 76 22 54 60 94 28 85 139
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
91 14 12 62 149 126 23 29 53 107 58 32 79 88 18 45
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
104 114 25 46 53 76 12 9 47 47 68 28 36 41 73 36
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
70 68 37 21 56 61 14 12 12 41 11 0 0 8 3 92
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
1025 985 981 820
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
525 1052 701 1533
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
501 1198 1318 794

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.