Viewing data for Carduelis pinus


Scientific name Carduelis pinus
Common name Pine siskin
Maximum lifespan 11.00 years (Carduelis pinus@AnAge)

Total mtDNA (size: 16812 bases) GC AT G C A T
Base content (bases) 7596 9215 5265 2331 4012 5203
Base content per 1 kb (bases) 452 548 313 139 239 309
Base content (%) 45.2% 54.8%
Total protein-coding genes (size: 11378 bases) GC AT G C A T
Base content (bases) 5237 6140 3856 1381 2694 3446
Base content per 1 kb (bases) 460 540 339 121 237 303
Base content (%) 46.0% 54.0%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1541 bases) GC AT G C A T
Base content (bases) 635 906 372 263 392 514
Base content per 1 kb (bases) 412 588 241 171 254 334
Base content (%) 41.2% 58.8%
Total rRNA-coding genes (size: 2571 bases) GC AT G C A T
Base content (bases) 1158 1413 640 518 560 853
Base content per 1 kb (bases) 450 550 249 201 218 332
Base content (%) 45.0% 55.0%
12S rRNA gene (size: 974 bases) GC AT G C A T
Base content (bases) 464 510 262 202 208 302
Base content per 1 kb (bases) 476 524 269 207 214 310
Base content (%) 47.6% 52.4%
16S rRNA gene (size: 1597 bases) GC AT G C A T
Base content (bases) 694 903 378 316 352 551
Base content per 1 kb (bases) 435 565 237 198 220 345
Base content (%) 43.5% 56.5%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 309 375 242 67 169 206
Base content per 1 kb (bases) 452 548 354 98 247 301
Base content (%) 45.2% 54.8%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 72 96 60 12 45 51
Base content per 1 kb (bases) 429 571 357 71 268 304
Base content (%) 42.9% 57.1%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 718 832 475 243 391 441
Base content per 1 kb (bases) 463 536 306 157 252 284
Base content (%) 46.3% 53.6%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 311 373 213 98 158 215
Base content per 1 kb (bases) 455 545 311 143 231 314
Base content (%) 45.5% 54.5%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 378 406 261 117 182 224
Base content per 1 kb (bases) 482 518 333 149 232 286
Base content (%) 48.2% 51.8%
CYTB (size: 1143 bases) GC AT G C A T
Base content (bases) 533 610 386 147 281 329
Base content per 1 kb (bases) 466 534 338 129 246 288
Base content (%) 46.6% 53.4%
ND1 (size: 978 bases) GC AT G C A T
Base content (bases) 436 542 311 125 259 283
Base content per 1 kb (bases) 446 554 318 128 265 289
Base content (%) 44.6% 55.4%
ND2 (size: 1040 bases) GC AT G C A T
Base content (bases) 456 584 355 101 259 325
Base content per 1 kb (bases) 438 562 341 97 249 313
Base content (%) 43.8% 56.2%
ND3 (size: 351 bases) GC AT G C A T
Base content (bases) 163 188 118 45 91 97
Base content per 1 kb (bases) 464 536 336 128 259 276
Base content (%) 46.4% 53.6%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 633 745 490 143 318 427
Base content per 1 kb (bases) 459 541 356 104 231 310
Base content (%) 45.9% 54.1%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 145 152 111 34 70 82
Base content per 1 kb (bases) 488 512 374 114 236 276
Base content (%) 48.8% 51.2%
ND5 (size: 1818 bases) GC AT G C A T
Base content (bases) 836 982 628 208 420 562
Base content per 1 kb (bases) 460 540 345 114 231 309
Base content (%) 46.0% 54.0%
ND6 (size: 519 bases) GC AT G C A T
Base content (bases) 252 267 209 43 55 212
Base content per 1 kb (bases) 486 514 403 83 106 408
Base content (%) 48.6% 51.4%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 15 (6.61%)
Serine (Ser, S)
n = 14 (6.17%)
Threonine (Thr, T)
n = 25 (11.01%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (3.96%)
Leucine (Leu, L)
n = 61 (26.87%)
Isoleucine (Ile, I)
n = 18 (7.93%)
Methionine (Met, M)
n = 8 (3.52%)
Proline (Pro, P)
n = 15 (6.61%)
Phenylalanine (Phe, F)
n = 11 (4.85%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 3 (1.32%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 9 (3.96%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 14 7 5 13 33 4 6 7 1 1 2 5 1 1 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 2 10 3 0 2 4 2 0 2 4 9 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 12 0 2 4 5 0 1 2 1 2 0 0 0 9 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 0 0 3 4 0 0 2 2 1 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
39 86 67 36
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
20 66 35 107
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 90 104 26
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPAPWFFIMIISWLTFSLIIQPKILTFVTMNPPSNKPPIAPSTTPWTWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 2 (3.64%)
Serine (Ser, S)
n = 4 (7.27%)
Threonine (Thr, T)
n = 7 (12.73%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.82%)
Leucine (Leu, L)
n = 4 (7.27%)
Isoleucine (Ile, I)
n = 7 (12.73%)
Methionine (Met, M)
n = 3 (5.45%)
Proline (Pro, P)
n = 11 (20.0%)
Phenylalanine (Phe, F)
n = 4 (7.27%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 3 (5.45%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 2 (3.64%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 4 1 1 2 1 0 0 1 1 0 0 1 0 3 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 0 1 1 0 0 0 0 0 3 4 4 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 2 0 0 2 1 0 1 0 0 0 0 0 1 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 0 0 2 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
3 17 23 13
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 23 8 19
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 20 20 13
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.11%)
Alanine (Ala, A)
n = 45 (8.72%)
Serine (Ser, S)
n = 28 (5.43%)
Threonine (Thr, T)
n = 37 (7.17%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 40 (7.75%)
Leucine (Leu, L)
n = 63 (12.21%)
Isoleucine (Ile, I)
n = 41 (7.95%)
Methionine (Met, M)
n = 22 (4.26%)
Proline (Pro, P)
n = 30 (5.81%)
Phenylalanine (Phe, F)
n = 43 (8.33%)
Tyrosine (Tyr, Y)
n = 17 (3.29%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 15 (2.91%)
Glutamine (Gln, Q)
n = 9 (1.74%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 28 20 6 14 39 0 4 9 0 9 10 18 3 5 38
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 9 17 19 0 11 8 26 1 4 11 15 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 16 1 4 9 11 0 0 4 4 13 0 0 1 14 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
17 10 0 2 13 9 0 1 2 5 0 0 1 0 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
156 125 129 106
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 136 94 209
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 214 218 76
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 16 (7.05%)
Serine (Ser, S)
n = 21 (9.25%)
Threonine (Thr, T)
n = 16 (7.05%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 17 (7.49%)
Leucine (Leu, L)
n = 29 (12.78%)
Isoleucine (Ile, I)
n = 14 (6.17%)
Methionine (Met, M)
n = 12 (5.29%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 9 (3.96%)
Tyrosine (Tyr, Y)
n = 7 (3.08%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 13 (5.73%)
Glutamic acid (Glu, E)
n = 12 (5.29%)
Asparagine (Asn, N)
n = 7 (3.08%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 9 (3.96%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 10 10 1 9 15 1 3 6 0 3 4 10 0 1 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 3 4 7 5 0 1 2 5 0 3 4 6 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 8 1 5 5 6 0 0 5 0 7 0 0 1 6 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 12 0 2 11 4 0 1 2 2 1 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 60 58 44
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
27 61 59 81
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 92 98 33
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.31%)
Alanine (Ala, A)
n = 25 (9.62%)
Serine (Ser, S)
n = 18 (6.92%)
Threonine (Thr, T)
n = 21 (8.08%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 14 (5.38%)
Leucine (Leu, L)
n = 33 (12.69%)
Isoleucine (Ile, I)
n = 16 (6.15%)
Methionine (Met, M)
n = 7 (2.69%)
Proline (Pro, P)
n = 14 (5.38%)
Phenylalanine (Phe, F)
n = 23 (8.85%)
Tyrosine (Tyr, Y)
n = 10 (3.85%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 3 (1.15%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 14 6 1 5 24 1 2 7 1 4 2 8 0 3 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 1 17 7 0 1 6 12 0 4 2 7 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 11 0 4 4 4 0 0 6 3 7 0 0 0 3 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
16 8 0 1 3 3 0 0 1 4 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 75 56 60
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 72 53 93
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 114 115 28
CYTB (size: 1143 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.32%)
Alanine (Ala, A)
n = 28 (7.37%)
Serine (Ser, S)
n = 22 (5.79%)
Threonine (Thr, T)
n = 26 (6.84%)
Cysteine (Cys, C)
n = 4 (1.05%)
Valine (Val, V)
n = 24 (6.32%)
Leucine (Leu, L)
n = 62 (16.32%)
Isoleucine (Ile, I)
n = 34 (8.95%)
Methionine (Met, M)
n = 7 (1.84%)
Proline (Pro, P)
n = 24 (6.32%)
Phenylalanine (Phe, F)
n = 28 (7.37%)
Tyrosine (Tyr, Y)
n = 12 (3.16%)
Tryptophan (Trp, W)
n = 11 (2.89%)
Aspartic acid (Asp, D)
n = 8 (2.11%)
Glutamic acid (Glu, E)
n = 7 (1.84%)
Asparagine (Asn, N)
n = 21 (5.53%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 12 (3.16%)
Lysine (Lys, K)
n = 10 (2.63%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 24 5 5 15 38 2 2 7 1 5 7 12 0 4 24
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 4 4 16 8 0 5 7 11 1 4 7 12 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 15 0 4 7 9 1 0 1 1 11 0 0 1 20 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 7 0 1 7 10 0 2 3 3 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
91 112 99 79
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
48 99 79 155
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 175 151 47
ND1 (size: 978 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.31%)
Alanine (Ala, A)
n = 31 (9.54%)
Serine (Ser, S)
n = 25 (7.69%)
Threonine (Thr, T)
n = 19 (5.85%)
Cysteine (Cys, C)
n = 3 (0.92%)
Valine (Val, V)
n = 15 (4.62%)
Leucine (Leu, L)
n = 66 (20.31%)
Isoleucine (Ile, I)
n = 24 (7.38%)
Methionine (Met, M)
n = 11 (3.38%)
Proline (Pro, P)
n = 25 (7.69%)
Phenylalanine (Phe, F)
n = 17 (5.23%)
Tyrosine (Tyr, Y)
n = 16 (4.92%)
Tryptophan (Trp, W)
n = 8 (2.46%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.38%)
Asparagine (Asn, N)
n = 13 (4.0%)
Glutamine (Gln, Q)
n = 6 (1.85%)
Histidine (His, H)
n = 2 (0.62%)
Lysine (Lys, K)
n = 7 (2.15%)
Arginine (Arg, R)
n = 8 (2.46%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 13 8 6 16 35 2 7 6 0 2 2 11 0 3 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 3 8 6 17 0 2 5 5 2 0 13 12 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 6 0 6 6 6 1 0 6 7 9 0 0 2 11 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 9 2 3 1 7 0 2 1 5 0 1 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
75 100 81 70
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
40 94 59 133
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 117 143 56
ND2 (size: 1040 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.77%)
Alanine (Ala, A)
n = 23 (6.67%)
Serine (Ser, S)
n = 33 (9.57%)
Threonine (Thr, T)
n = 44 (12.75%)
Cysteine (Cys, C)
n = 2 (0.58%)
Valine (Val, V)
n = 10 (2.9%)
Leucine (Leu, L)
n = 66 (19.13%)
Isoleucine (Ile, I)
n = 36 (10.43%)
Methionine (Met, M)
n = 16 (4.64%)
Proline (Pro, P)
n = 20 (5.8%)
Phenylalanine (Phe, F)
n = 12 (3.48%)
Tyrosine (Tyr, Y)
n = 7 (2.03%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 11 (3.19%)
Glutamine (Gln, Q)
n = 10 (2.9%)
Histidine (His, H)
n = 9 (2.61%)
Lysine (Lys, K)
n = 14 (4.06%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 25 12 5 19 34 6 2 9 1 0 6 3 1 3 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 2 0 3 9 11 0 2 4 7 0 7 5 8 0 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 14 1 5 11 12 0 1 4 2 5 1 0 3 8 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 4 1 0 1 14 0 0 2 2 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
52 107 126 61
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 115 57 140
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 133 141 57
ND3 (size: 1040 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.77%)
Alanine (Ala, A)
n = 23 (6.67%)
Serine (Ser, S)
n = 33 (9.57%)
Threonine (Thr, T)
n = 44 (12.75%)
Cysteine (Cys, C)
n = 2 (0.58%)
Valine (Val, V)
n = 10 (2.9%)
Leucine (Leu, L)
n = 66 (19.13%)
Isoleucine (Ile, I)
n = 36 (10.43%)
Methionine (Met, M)
n = 16 (4.64%)
Proline (Pro, P)
n = 20 (5.8%)
Phenylalanine (Phe, F)
n = 12 (3.48%)
Tyrosine (Tyr, Y)
n = 7 (2.03%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 11 (3.19%)
Glutamine (Gln, Q)
n = 10 (2.9%)
Histidine (His, H)
n = 9 (2.61%)
Lysine (Lys, K)
n = 14 (4.06%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 25 12 5 19 34 6 2 9 1 0 6 3 1 3 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 2 0 3 9 11 0 2 4 7 0 7 5 8 0 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 14 1 5 11 12 0 1 4 2 5 1 0 3 8 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 4 1 0 1 14 0 0 2 2 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
52 107 126 61
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 115 57 140
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 133 141 57
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (3.71%)
Alanine (Ala, A)
n = 43 (9.39%)
Serine (Ser, S)
n = 37 (8.08%)
Threonine (Thr, T)
n = 38 (8.3%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 9 (1.97%)
Leucine (Leu, L)
n = 98 (21.4%)
Isoleucine (Ile, I)
n = 47 (10.26%)
Methionine (Met, M)
n = 26 (5.68%)
Proline (Pro, P)
n = 27 (5.9%)
Phenylalanine (Phe, F)
n = 12 (2.62%)
Tyrosine (Tyr, Y)
n = 13 (2.84%)
Tryptophan (Trp, W)
n = 12 (2.62%)
Aspartic acid (Asp, D)
n = 2 (0.44%)
Glutamic acid (Glu, E)
n = 10 (2.18%)
Asparagine (Asn, N)
n = 16 (3.49%)
Glutamine (Gln, Q)
n = 14 (3.06%)
Histidine (His, H)
n = 14 (3.06%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 39 25 11 31 43 4 9 14 0 2 3 4 0 2 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 3 8 18 16 1 2 6 8 1 3 12 12 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 17 0 3 11 13 0 0 10 1 12 0 0 3 13 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 9 1 1 1 9 1 0 1 10 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
81 155 147 76
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 135 79 192
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 200 201 49
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 9 (9.18%)
Serine (Ser, S)
n = 13 (13.27%)
Threonine (Thr, T)
n = 8 (8.16%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 2 (2.04%)
Leucine (Leu, L)
n = 19 (19.39%)
Isoleucine (Ile, I)
n = 5 (5.1%)
Methionine (Met, M)
n = 7 (7.14%)
Proline (Pro, P)
n = 3 (3.06%)
Phenylalanine (Phe, F)
n = 5 (5.1%)
Tyrosine (Tyr, Y)
n = 3 (3.06%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 3 (3.06%)
Histidine (His, H)
n = 6 (6.12%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 5 6 1 5 12 1 0 3 0 0 1 1 0 1 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 3 2 5 2 0 1 2 1 0 1 0 2 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 2 0 1 5 3 0 0 4 1 2 0 0 0 2 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 2 0 0 1 0 0 0 0 2 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
18 33 26 22
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
14 29 18 38
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 49 38 10
ND5 (size: 1818 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 33 (5.45%)
Alanine (Ala, A)
n = 50 (8.26%)
Serine (Ser, S)
n = 50 (8.26%)
Threonine (Thr, T)
n = 66 (10.91%)
Cysteine (Cys, C)
n = 6 (0.99%)
Valine (Val, V)
n = 18 (2.98%)
Leucine (Leu, L)
n = 105 (17.36%)
Isoleucine (Ile, I)
n = 52 (8.6%)
Methionine (Met, M)
n = 31 (5.12%)
Proline (Pro, P)
n = 31 (5.12%)
Phenylalanine (Phe, F)
n = 35 (5.79%)
Tyrosine (Tyr, Y)
n = 12 (1.98%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 9 (1.49%)
Glutamic acid (Glu, E)
n = 12 (1.98%)
Asparagine (Asn, N)
n = 26 (4.3%)
Glutamine (Gln, Q)
n = 16 (2.64%)
Histidine (His, H)
n = 13 (2.15%)
Lysine (Lys, K)
n = 20 (3.31%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 40 29 7 27 60 4 7 13 3 5 5 7 1 5 30
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 5 8 26 16 0 0 12 18 3 11 14 6 0 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
33 23 0 4 16 18 1 0 11 0 12 0 0 4 22 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 12 0 1 8 19 1 0 2 6 0 1 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
122 166 207 111
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
71 186 108 241
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 276 247 68
ND6 (size: 519 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 30 (17.44%)
Alanine (Ala, A)
n = 12 (6.98%)
Serine (Ser, S)
n = 14 (8.14%)
Threonine (Thr, T)
n = 2 (1.16%)
Cysteine (Cys, C)
n = 2 (1.16%)
Valine (Val, V)
n = 33 (19.19%)
Leucine (Leu, L)
n = 33 (19.19%)
Isoleucine (Ile, I)
n = 2 (1.16%)
Methionine (Met, M)
n = 7 (4.07%)
Proline (Pro, P)
n = 4 (2.33%)
Phenylalanine (Phe, F)
n = 8 (4.65%)
Tyrosine (Tyr, Y)
n = 7 (4.07%)
Tryptophan (Trp, W)
n = 4 (2.33%)
Aspartic acid (Asp, D)
n = 2 (1.16%)
Glutamic acid (Glu, E)
n = 6 (3.49%)
Asparagine (Asn, N)
n = 2 (1.16%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 4 (2.33%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 0 1 5 0 0 0 11 0 0 15 0 3 15 7 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 2 0 5 0 1 6 11 0 1 18 1 0 1 2 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 1 6 0 0 4 4 0 7 0 3 17 1 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 5 2 0 0 0 0 0 0 4 0 0 0 1 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
83 13 17 60
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 28 18 83
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
82 2 20 69
Total protein-coding genes (size: 11395 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 222 (5.85%)
Alanine (Ala, A)
n = 306 (8.06%)
Serine (Ser, S)
n = 287 (7.56%)
Threonine (Thr, T)
n = 318 (8.38%)
Cysteine (Cys, C)
n = 29 (0.76%)
Valine (Val, V)
n = 193 (5.08%)
Leucine (Leu, L)
n = 669 (17.62%)
Isoleucine (Ile, I)
n = 304 (8.01%)
Methionine (Met, M)
n = 162 (4.27%)
Proline (Pro, P)
n = 224 (5.9%)
Phenylalanine (Phe, F)
n = 216 (5.69%)
Tyrosine (Tyr, Y)
n = 109 (2.87%)
Tryptophan (Trp, W)
n = 106 (2.79%)
Aspartic acid (Asp, D)
n = 65 (1.71%)
Glutamic acid (Glu, E)
n = 94 (2.48%)
Asparagine (Asn, N)
n = 131 (3.45%)
Glutamine (Gln, Q)
n = 93 (2.45%)
Histidine (His, H)
n = 104 (2.74%)
Lysine (Lys, K)
n = 84 (2.21%)
Arginine (Arg, R)
n = 71 (1.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
81 223 135 56 163 346 31 55 85 8 46 42 84 21 40 176
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
27 5 24 56 135 108 7 38 58 98 27 44 79 97 4 48
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
139 127 4 46 82 91 7 7 54 27 82 4 18 17 114 12
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
92 85 9 13 52 82 2 6 16 43 6 2 1 6 1 102
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
879 1088 1063 766
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
491 1074 687 1544
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
177 1531 1546 542

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.