Viewing data for Anser fabalis


Scientific name Anser fabalis
Common name Bean goose
Maximum lifespan 25.60 years (Anser fabalis@AnAge)

Total mtDNA (size: 16688 bases) GC AT G C A T
Base content (bases) 7877 8811 5314 2563 3793 5018
Base content per 1 kb (bases) 472 528 318 154 227 301
Base content (%) 47.2% 52.8%
Total protein-coding genes (size: 11345 bases) GC AT G C A T
Base content (bases) 5444 5901 3864 1580 2562 3339
Base content per 1 kb (bases) 480 520 341 139 226 294
Base content (%) 48.0% 52.0%
D-loop (size: 1182 bases) GC AT G C A T
Base content (bases) 547 635 368 179 314 321
Base content per 1 kb (bases) 463 537 311 151 266 272
Base content (%) 46.3% 53.7%
Total tRNA-coding genes (size: 1534 bases) GC AT G C A T
Base content (bases) 654 880 389 265 373 507
Base content per 1 kb (bases) 426 574 254 173 243 331
Base content (%) 42.6% 57.4%
Total rRNA-coding genes (size: 2255 bases) GC AT G C A T
Base content (bases) 1038 1217 574 464 468 749
Base content per 1 kb (bases) 460 540 255 206 208 332
Base content (%) 46.0% 54.0%
12S rRNA gene (size: 984 bases) GC AT G C A T
Base content (bases) 481 503 260 221 200 303
Base content per 1 kb (bases) 489 511 264 225 203 308
Base content (%) 48.9% 51.1%
16S rRNA gene (size: 1271 bases) GC AT G C A T
Base content (bases) 557 714 314 243 268 446
Base content per 1 kb (bases) 438 562 247 191 211 351
Base content (%) 43.8% 56.2%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 313 371 238 75 159 212
Base content per 1 kb (bases) 458 542 348 110 232 310
Base content (%) 45.8% 54.2%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 76 92 65 11 34 58
Base content per 1 kb (bases) 452 548 387 65 202 345
Base content (%) 45.2% 54.8%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 749 802 493 256 379 423
Base content per 1 kb (bases) 483 517 318 165 244 273
Base content (%) 48.3% 51.7%
COX2 (size: 687 bases) GC AT G C A T
Base content (bases) 338 349 229 109 157 192
Base content per 1 kb (bases) 492 508 333 159 229 279
Base content (%) 49.2% 50.8%
COX3 (size: 785 bases) GC AT G C A T
Base content (bases) 390 395 266 124 176 219
Base content per 1 kb (bases) 497 503 339 158 224 279
Base content (%) 49.7% 50.3%
CYTB (size: 1131 bases) GC AT G C A T
Base content (bases) 554 577 395 159 259 318
Base content per 1 kb (bases) 490 510 349 141 229 281
Base content (%) 49.0% 51.0%
ND1 (size: 963 bases) GC AT G C A T
Base content (bases) 458 505 308 150 245 260
Base content per 1 kb (bases) 476 524 320 156 254 270
Base content (%) 47.6% 52.4%
ND2 (size: 1039 bases) GC AT G C A T
Base content (bases) 490 549 364 126 232 317
Base content per 1 kb (bases) 472 528 350 121 223 305
Base content (%) 47.2% 52.8%
ND3 (size: 351 bases) GC AT G C A T
Base content (bases) 178 173 121 57 86 87
Base content per 1 kb (bases) 507 493 345 162 245 248
Base content (%) 50.7% 49.3%
ND4 (size: 1379 bases) GC AT G C A T
Base content (bases) 642 737 476 166 321 416
Base content per 1 kb (bases) 466 534 345 120 233 302
Base content (%) 46.6% 53.4%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 146 151 99 47 74 77
Base content per 1 kb (bases) 492 508 333 158 249 259
Base content (%) 49.2% 50.8%
ND5 (size: 1818 bases) GC AT G C A T
Base content (bases) 853 965 615 238 390 575
Base content per 1 kb (bases) 469 531 338 131 215 316
Base content (%) 46.9% 53.1%
ND6 (size: 510 bases) GC AT G C A T
Base content (bases) 262 248 198 64 54 194
Base content per 1 kb (bases) 514 486 388 125 106 380
Base content (%) 51.4% 48.6%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 5 (2.2%)
Alanine (Ala, A)
n = 15 (6.61%)
Serine (Ser, S)
n = 19 (8.37%)
Threonine (Thr, T)
n = 23 (10.13%)
Cysteine (Cys, C)
n = 1 (0.44%)
Valine (Val, V)
n = 9 (3.96%)
Leucine (Leu, L)
n = 44 (19.38%)
Isoleucine (Ile, I)
n = 19 (8.37%)
Methionine (Met, M)
n = 12 (5.29%)
Proline (Pro, P)
n = 14 (6.17%)
Phenylalanine (Phe, F)
n = 10 (4.41%)
Tyrosine (Tyr, Y)
n = 4 (1.76%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 2 (0.88%)
Glutamic acid (Glu, E)
n = 6 (2.64%)
Asparagine (Asn, N)
n = 14 (6.17%)
Glutamine (Gln, Q)
n = 9 (3.96%)
Histidine (His, H)
n = 4 (1.76%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 8 (3.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 18 10 7 9 22 1 5 6 3 0 3 3 3 4 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 1 8 6 0 0 2 3 0 1 6 6 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 11 2 3 9 2 0 0 5 2 2 1 0 2 12 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 5 1 1 1 4 0 0 5 3 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
37 74 77 40
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
24 66 44 94
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 98 91 25
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPAPWFSIMIMTWLTLALLIQPKLLAFTTTNPPSNKTSLTTKPTPWSWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 3 (5.45%)
Serine (Ser, S)
n = 4 (7.27%)
Threonine (Thr, T)
n = 10 (18.18%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 8 (14.55%)
Isoleucine (Ile, I)
n = 3 (5.45%)
Methionine (Met, M)
n = 3 (5.45%)
Proline (Pro, P)
n = 9 (16.36%)
Phenylalanine (Phe, F)
n = 2 (3.64%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 3 (5.45%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 3 (5.45%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 2 2 1 3 3 0 1 1 1 0 0 0 0 1 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 1 2 0 0 0 0 0 0 3 6 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 2 0 0 2 2 0 0 0 0 0 0 0 1 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 0 0 2 1 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
3 18 22 13
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 26 9 16
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 21 27 5
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.11%)
Alanine (Ala, A)
n = 44 (8.53%)
Serine (Ser, S)
n = 27 (5.23%)
Threonine (Thr, T)
n = 40 (7.75%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 34 (6.59%)
Leucine (Leu, L)
n = 61 (11.82%)
Isoleucine (Ile, I)
n = 44 (8.53%)
Methionine (Met, M)
n = 24 (4.65%)
Proline (Pro, P)
n = 31 (6.01%)
Phenylalanine (Phe, F)
n = 42 (8.14%)
Tyrosine (Tyr, Y)
n = 17 (3.29%)
Tryptophan (Trp, W)
n = 18 (3.49%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 15 (2.91%)
Glutamine (Gln, Q)
n = 10 (1.94%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 34 21 2 13 35 6 5 8 2 5 13 15 1 16 26
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 8 25 11 0 4 14 25 4 3 16 10 2 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 12 3 1 11 10 2 0 3 2 15 0 0 1 14 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
17 8 2 3 12 7 2 0 1 7 0 0 1 0 0 18
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
150 124 136 107
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
78 139 95 205
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 230 192 67
COX2 (size: 687 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.82%)
Alanine (Ala, A)
n = 13 (5.7%)
Serine (Ser, S)
n = 24 (10.53%)
Threonine (Thr, T)
n = 13 (5.7%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 16 (7.02%)
Leucine (Leu, L)
n = 29 (12.72%)
Isoleucine (Ile, I)
n = 18 (7.89%)
Methionine (Met, M)
n = 7 (3.07%)
Proline (Pro, P)
n = 16 (7.02%)
Phenylalanine (Phe, F)
n = 9 (3.95%)
Tyrosine (Tyr, Y)
n = 8 (3.51%)
Tryptophan (Trp, W)
n = 5 (2.19%)
Aspartic acid (Asp, D)
n = 13 (5.7%)
Glutamic acid (Glu, E)
n = 11 (4.82%)
Asparagine (Asn, N)
n = 5 (2.19%)
Glutamine (Gln, Q)
n = 7 (3.07%)
Histidine (His, H)
n = 11 (4.82%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 5 (2.19%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 12 6 2 10 11 3 2 7 0 4 2 7 3 2 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 3 3 7 3 0 1 3 4 3 2 5 9 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 4 1 1 9 9 2 0 3 1 7 1 1 2 3 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 9 2 1 12 4 0 0 2 2 1 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
64 65 50 50
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
27 63 60 79
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 101 82 28
COX3 (size: 785 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 21 (8.08%)
Serine (Ser, S)
n = 18 (6.92%)
Threonine (Thr, T)
n = 21 (8.08%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 13 (5.0%)
Leucine (Leu, L)
n = 31 (11.92%)
Isoleucine (Ile, I)
n = 18 (6.92%)
Methionine (Met, M)
n = 10 (3.85%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 25 (9.62%)
Tyrosine (Tyr, Y)
n = 9 (3.46%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 4 (1.54%)
Glutamine (Gln, Q)
n = 6 (2.31%)
Histidine (His, H)
n = 18 (6.92%)
Lysine (Lys, K)
n = 4 (1.54%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 16 8 1 9 15 4 2 6 0 3 5 5 0 1 24
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 0 13 7 1 0 7 11 2 1 3 7 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 8 2 2 4 7 1 0 4 0 9 0 0 0 4 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
16 7 1 1 4 3 1 0 0 5 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 70 61 63
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 68 54 97
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 128 103 15
CYTB (size: 1131 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 23 (6.12%)
Alanine (Ala, A)
n = 34 (9.04%)
Serine (Ser, S)
n = 25 (6.65%)
Threonine (Thr, T)
n = 22 (5.85%)
Cysteine (Cys, C)
n = 5 (1.33%)
Valine (Val, V)
n = 18 (4.79%)
Leucine (Leu, L)
n = 63 (16.76%)
Isoleucine (Ile, I)
n = 32 (8.51%)
Methionine (Met, M)
n = 9 (2.39%)
Proline (Pro, P)
n = 24 (6.38%)
Phenylalanine (Phe, F)
n = 26 (6.91%)
Tyrosine (Tyr, Y)
n = 13 (3.46%)
Tryptophan (Trp, W)
n = 11 (2.93%)
Aspartic acid (Asp, D)
n = 9 (2.39%)
Glutamic acid (Glu, E)
n = 7 (1.86%)
Asparagine (Asn, N)
n = 18 (4.79%)
Glutamine (Gln, Q)
n = 8 (2.13%)
Histidine (His, H)
n = 11 (2.93%)
Lysine (Lys, K)
n = 10 (2.66%)
Arginine (Arg, R)
n = 8 (2.13%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 30 7 3 15 32 6 7 6 2 0 6 9 3 1 25
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 5 5 21 8 0 1 7 13 2 2 6 14 2 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 6 0 1 8 13 1 0 2 1 12 1 0 4 14 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 7 0 0 9 10 0 1 2 5 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
91 107 93 86
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
49 103 77 148
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 185 148 25
ND1 (size: 963 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 10 (3.13%)
Alanine (Ala, A)
n = 32 (10.0%)
Serine (Ser, S)
n = 31 (9.69%)
Threonine (Thr, T)
n = 22 (6.88%)
Cysteine (Cys, C)
n = 4 (1.25%)
Valine (Val, V)
n = 16 (5.0%)
Leucine (Leu, L)
n = 60 (18.75%)
Isoleucine (Ile, I)
n = 15 (4.69%)
Methionine (Met, M)
n = 17 (5.31%)
Proline (Pro, P)
n = 23 (7.19%)
Phenylalanine (Phe, F)
n = 15 (4.69%)
Tyrosine (Tyr, Y)
n = 15 (4.69%)
Tryptophan (Trp, W)
n = 10 (3.13%)
Aspartic acid (Asp, D)
n = 6 (1.88%)
Glutamic acid (Glu, E)
n = 9 (2.81%)
Asparagine (Asn, N)
n = 8 (2.5%)
Glutamine (Gln, Q)
n = 5 (1.56%)
Histidine (His, H)
n = 7 (2.19%)
Lysine (Lys, K)
n = 7 (2.19%)
Arginine (Arg, R)
n = 8 (2.5%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 9 13 2 14 36 4 2 3 2 3 8 3 2 4 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 4 7 12 10 3 2 2 4 2 8 7 8 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 12 1 4 5 9 3 0 10 4 11 1 2 1 7 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 5 4 1 5 4 3 1 0 5 2 0 1 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
73 99 80 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 98 57 123
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
34 111 123 53
ND2 (size: 1039 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (3.19%)
Alanine (Ala, A)
n = 38 (11.01%)
Serine (Ser, S)
n = 31 (8.99%)
Threonine (Thr, T)
n = 36 (10.43%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 12 (3.48%)
Leucine (Leu, L)
n = 65 (18.84%)
Isoleucine (Ile, I)
n = 24 (6.96%)
Methionine (Met, M)
n = 20 (5.8%)
Proline (Pro, P)
n = 23 (6.67%)
Phenylalanine (Phe, F)
n = 13 (3.77%)
Tyrosine (Tyr, Y)
n = 8 (2.32%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 12 (3.48%)
Glutamine (Gln, Q)
n = 9 (2.61%)
Histidine (His, H)
n = 9 (2.61%)
Lysine (Lys, K)
n = 14 (4.06%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 17 14 7 12 29 10 7 8 1 2 4 5 1 3 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 0 3 23 10 2 0 7 4 0 2 7 14 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 19 1 2 12 8 2 0 7 0 8 1 0 3 9 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 4 1 0 2 13 1 0 2 1 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 102 113 63
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 121 59 134
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
26 141 145 34
ND3 (size: 1039 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (3.19%)
Alanine (Ala, A)
n = 38 (11.01%)
Serine (Ser, S)
n = 31 (8.99%)
Threonine (Thr, T)
n = 36 (10.43%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 12 (3.48%)
Leucine (Leu, L)
n = 65 (18.84%)
Isoleucine (Ile, I)
n = 24 (6.96%)
Methionine (Met, M)
n = 20 (5.8%)
Proline (Pro, P)
n = 23 (6.67%)
Phenylalanine (Phe, F)
n = 13 (3.77%)
Tyrosine (Tyr, Y)
n = 8 (2.32%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 12 (3.48%)
Glutamine (Gln, Q)
n = 9 (2.61%)
Histidine (His, H)
n = 9 (2.61%)
Lysine (Lys, K)
n = 14 (4.06%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 17 14 7 12 29 10 7 8 1 2 4 5 1 3 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 0 3 23 10 2 0 7 4 0 2 7 14 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 19 1 2 12 8 2 0 7 0 8 1 0 3 9 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 4 1 0 2 13 1 0 2 1 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 102 113 63
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 121 59 134
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
26 141 145 34
ND4 (size: 1379 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (4.59%)
Alanine (Ala, A)
n = 29 (6.33%)
Serine (Ser, S)
n = 39 (8.52%)
Threonine (Thr, T)
n = 46 (10.04%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 11 (2.4%)
Leucine (Leu, L)
n = 99 (21.62%)
Isoleucine (Ile, I)
n = 39 (8.52%)
Methionine (Met, M)
n = 27 (5.9%)
Proline (Pro, P)
n = 27 (5.9%)
Phenylalanine (Phe, F)
n = 18 (3.93%)
Tyrosine (Tyr, Y)
n = 14 (3.06%)
Tryptophan (Trp, W)
n = 12 (2.62%)
Aspartic acid (Asp, D)
n = 4 (0.87%)
Glutamic acid (Glu, E)
n = 8 (1.75%)
Asparagine (Asn, N)
n = 12 (2.62%)
Glutamine (Gln, Q)
n = 15 (3.28%)
Histidine (His, H)
n = 14 (3.06%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 31 21 2 18 56 14 8 11 4 2 4 4 1 7 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 3 4 15 10 0 1 8 9 3 1 11 15 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
23 15 4 4 13 14 0 0 8 2 12 3 1 1 11 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 7 1 1 3 9 1 1 2 8 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
73 157 142 87
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
55 133 77 194
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
38 186 196 39
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 6 (6.12%)
Alanine (Ala, A)
n = 7 (7.14%)
Serine (Ser, S)
n = 14 (14.29%)
Threonine (Thr, T)
n = 6 (6.12%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 5 (5.1%)
Leucine (Leu, L)
n = 18 (18.37%)
Isoleucine (Ile, I)
n = 4 (4.08%)
Methionine (Met, M)
n = 7 (7.14%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 7 (7.14%)
Tyrosine (Tyr, Y)
n = 1 (1.02%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 3 (3.06%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 6 (6.12%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 2 4 1 2 11 2 2 2 0 0 1 4 0 0 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 2 0 5 0 2 0 4 2 0 0 1 1 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 2 0 0 5 4 2 0 3 0 1 0 0 0 3 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 2 1 0 1 0 0 0 1 1 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
22 28 23 26
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
15 26 17 41
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 45 37 7
ND5 (size: 1818 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 33 (5.45%)
Alanine (Ala, A)
n = 58 (9.59%)
Serine (Ser, S)
n = 39 (6.45%)
Threonine (Thr, T)
n = 63 (10.41%)
Cysteine (Cys, C)
n = 6 (0.99%)
Valine (Val, V)
n = 23 (3.8%)
Leucine (Leu, L)
n = 98 (16.2%)
Isoleucine (Ile, I)
n = 50 (8.26%)
Methionine (Met, M)
n = 33 (5.45%)
Proline (Pro, P)
n = 32 (5.29%)
Phenylalanine (Phe, F)
n = 34 (5.62%)
Tyrosine (Tyr, Y)
n = 11 (1.82%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 7 (1.16%)
Glutamic acid (Glu, E)
n = 13 (2.15%)
Asparagine (Asn, N)
n = 27 (4.46%)
Glutamine (Gln, Q)
n = 19 (3.14%)
Histidine (His, H)
n = 15 (2.48%)
Lysine (Lys, K)
n = 23 (3.8%)
Arginine (Arg, R)
n = 9 (1.49%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 43 30 5 23 53 12 4 18 1 1 6 14 2 10 24
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 6 9 33 15 1 1 6 23 3 1 15 16 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
34 21 1 4 11 13 2 1 8 0 11 1 1 5 22 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 9 4 2 5 20 3 0 3 6 0 1 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
134 168 206 98
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
70 183 115 238
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
34 264 254 54
ND6 (size: 510 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (16.57%)
Alanine (Ala, A)
n = 15 (8.88%)
Serine (Ser, S)
n = 15 (8.88%)
Threonine (Thr, T)
n = 4 (2.37%)
Cysteine (Cys, C)
n = 6 (3.55%)
Valine (Val, V)
n = 25 (14.79%)
Leucine (Leu, L)
n = 23 (13.61%)
Isoleucine (Ile, I)
n = 3 (1.78%)
Methionine (Met, M)
n = 7 (4.14%)
Proline (Pro, P)
n = 2 (1.18%)
Phenylalanine (Phe, F)
n = 14 (8.28%)
Tyrosine (Tyr, Y)
n = 5 (2.96%)
Tryptophan (Trp, W)
n = 7 (4.14%)
Aspartic acid (Asp, D)
n = 3 (1.78%)
Glutamic acid (Glu, E)
n = 1 (0.59%)
Asparagine (Asn, N)
n = 3 (1.78%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 3 (1.78%)
Lysine (Lys, K)
n = 1 (0.59%)
Arginine (Arg, R)
n = 4 (2.37%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 0 0 2 0 0 7 6 0 0 11 2 2 10 10 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 4 2 4 1 4 6 9 0 1 18 1 0 0 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 1 3 2 1 4 1 4 5 0 7 8 3 0 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 1 3 0 0 1 0 0 0 4 0 0 0 1 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
72 18 23 57
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
50 31 17 72
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
76 15 14 65
Total protein-coding genes (size: 11363 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 220 (5.81%)
Alanine (Ala, A)
n = 321 (8.48%)
Serine (Ser, S)
n = 294 (7.77%)
Threonine (Thr, T)
n = 311 (8.22%)
Cysteine (Cys, C)
n = 35 (0.92%)
Valine (Val, V)
n = 188 (4.97%)
Leucine (Leu, L)
n = 626 (16.54%)
Isoleucine (Ile, I)
n = 274 (7.24%)
Methionine (Met, M)
n = 181 (4.78%)
Proline (Pro, P)
n = 222 (5.87%)
Phenylalanine (Phe, F)
n = 224 (5.92%)
Tyrosine (Tyr, Y)
n = 107 (2.83%)
Tryptophan (Trp, W)
n = 113 (2.99%)
Aspartic acid (Asp, D)
n = 70 (1.85%)
Glutamic acid (Glu, E)
n = 87 (2.3%)
Asparagine (Asn, N)
n = 127 (3.36%)
Glutamine (Gln, Q)
n = 96 (2.54%)
Histidine (His, H)
n = 117 (3.09%)
Lysine (Lys, K)
n = 90 (2.38%)
Arginine (Arg, R)
n = 73 (1.93%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
56 218 138 37 139 312 72 53 80 16 31 57 73 27 59 165
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
43 7 28 45 172 89 15 19 61 102 38 22 83 109 8 44
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
138 113 16 26 92 97 19 2 58 17 90 16 13 23 104 20
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
97 67 20 13 57 77 13 3 18 45 7 1 2 6 1 97
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
886 1068 1046 786
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
504 1088 701 1493
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
326 1577 1459 424

<!DOCTYPE html>
<html lang="en" >
<head >
    <meta charset="UTF-8">
    <meta http-equiv="X-UA-Compatible" content="IE=edge">
    <meta name="HandheldFriendly" content="True">
    <meta name="MobileOptimized" content="320">
    <meta name="viewport" content="width=device-width, initial-scale=1.0">
    <title>400 Error - NCBI</title>
    <meta name="viewport" content="width=device-width, initial-scale=1, shrink-to-fit=no">
    <meta http-equiv="X-UA-Compatible" content="IE=edge" />
    <meta http-equiv="Content-Type" content="text/html; charset=utf-8" />
    <meta http-equiv="X-UA-Compatible" content="IE=edge,chrome=1" />
    <meta name="title" content="400 Error - NCBI">
    <meta name="robots" content="noindex">
    <meta name="googlebot" content="noindex">
    <style>

      /* USWDS Banner Styles */
      .usa-banner{
        background-color:#f1f1f1;
        padding-bottom:0.7rem;
      }

      @media screen and (min-width: 481px){
        .usa-banner{
          font-size:1.3rem;
          padding-bottom:0;
        }
      }

      .usa-banner .usa-accordion, .usa-banner .usa-accordion-bordered{
        margin-top:0;
        margin-bottom:0;
        list-style-type:none;
        padding-left:0;
        color:#212121;
        margin:0;
        padding:0;
        width:100%;
      }

      .usa-banner .usa-banner-header{
        padding-top:0.55rem;
        padding-bottom:0.55rem;
        font-size:0.75rem;
        font-weight:400;
      }

      @media screen and (min-width: 481px){
        .usa-banner .usa-banner-header{
          padding-top:0;
          padding-bottom:0;
        }
      }

      .usa-banner .usa-banner-inner{
        max-width:1040px;
        margin-left:auto;
        margin-right:auto;
        padding-right:1.5rem;
        padding-left:1.5rem;
      }

      .usa-banner .usa-banner-inner::after{
        clear:both;
        content:"";
        display:block;
      }

      @media screen and (min-width: 951px){
        .usa-banner .usa-banner-inner{
          padding-right:3rem;
          padding-left:3rem;
        }
      }

      .usa-banner .usa-banner-header-expanded{
        -ms-flex-align:center;
        align-items:center;
        border-bottom:1px solid #aeb0b5;
        display:-ms-flexbox;
        display:flex;
        font-size:0.75rem;
        min-height:0rem;
        padding-right:3rem;
      }

      @media screen and (min-width: 481px){
        .usa-banner .usa-banner-header-expanded{
          border-bottom:none;
          display:block;
          font-size:0.75rem;
          font-weight:400;
          min-height:0;
          padding-right:0;
        }
      }

      .usa-banner .usa-banner-header-expanded > .usa-banner-inner{
        margin-left:0;
      }

      @media screen and (min-width: 481px){
        .usa-banner .usa-banner-header-expanded > .usa-banner-inner{
          margin-left:auto;
        }
      }

      .usa-banner .usa-section > :first-child,
      .usa-banner .usa-grid > :first-child,
      .usa-banner .usa-grid-full > :first-child{
        margin-top:0;
      }

      .usa-banner .usa-section > :last-child,
      .usa-banner .usa-grid > :last-child,
      .usa-banner .usa-grid-full > :last-child{
        margin-bottom:0;
      }

      .usa-banner img{
        border:0;
      }

      .usa-banner img{
        max-width:100%;
      }

      .usa-banner .usa-banner-header img{
        float:left;
        margin-right:1rem;
        margin-top:1px;
        width:1.5rem;
      }

      @media screen and (min-width: 481px){
        .usa-banner .usa-banner-header img{
          margin-right:0.7rem;
          width:1.3rem;
        }
      }

      .usa-banner .usa-banner-header-expanded img{
        margin-right:1rem;
      }

      @media screen and (min-width: 481px){
        .usa-banner .usa-banner-header-expanded img{
          margin-right:0.7rem;
        }
      }

      .usa-banner p{
        line-height:1.5;
        /*margin-bottom:1em;
        margin-top:1em;*/
      }

      .usa-banner .usa-banner-header p{
        margin-top:0;
        margin-bottom:0;
        display:inline;
        overflow:hidden;
        vertical-align:middle;
      }

      @media screen and (min-width: 481px){
        .usa-banner .usa-banner-header p{
          margin-top:2px;
          margin-bottom:2px;
          display:inline-block;
        }
      }

      .usa-banner .usa-banner-header-expanded p{
        line-height:1.3;
        vertical-align:top;
        font-size: 0.95rem;
      }

      @media screen and (min-width: 481px){
        .usa-banner .usa-banner-header-expanded p{
          line-height:1.5;
          vertical-align:middle;
          font-size: 0.75rem;
        }
      }

      .usa-banner .usa-accordion-button.usa-banner-button{
        background-color:transparent;
        border:0;
        border-radius:0;
        font-weight:400;
        margin:0;
        padding:0;
        text-align:left;
        -webkit-font-smoothing:auto;
        padding-top:0;
        padding-left:4.0rem;
        background-position-x:right;
        color:#0071bc;
        display:block;
        font-size:0.7rem;
        height:4.3rem;
        left:0;
        position:absolute;
        text-decoration:underline;
        top:0;
        width:100%;
      }

      .usa-banner .usa-banner-button:hover{
        background-color:transparent;
      }

      @media screen and (min-width: 481px){
        .usa-banner .usa-accordion-button.usa-banner-button{
          padding-top:0;
          padding-left:0;
          display:inline;
          height:auto;
          margin-left:3px;
          position:relative;
          vertical-align:middle;
          width:auto;
        }
      }

      .usa-banner .usa-accordion-button.usa-banner-button:hover{
        color:#205493;
        text-decoration:underline;
      }

      .usa-banner .usa-accordion-button.usa-banner-button[aria-expanded=false]{
        background-image:none;
      }

      .usa-banner .usa-banner-button[aria-expanded=false]::after{
        background-image:url("https://www.ncbi.nlm.nih.gov/style-guide/static/django_uswds/uswds/img/angle-arrow-down-primary.png");
        background-image:url("https://www.ncbi.nlm.nih.gov/style-guide/static/django_uswds/uswds/img/angle-arrow-down-primary.svg");
        background-size:100%;
        content:'';
        display:inline-block;
        height:0.7rem;
        width:0.7rem;
        margin-left:0;
      }

      .usa-banner .usa-banner-button[aria-expanded=false]:hover::after{
        background-image:url("https://www.ncbi.nlm.nih.gov/style-guide/static/django_uswds/uswds/img/angle-arrow-down-primary-hover.png");
        background-image:url("https://www.ncbi.nlm.nih.gov/style-guide/static/django_uswds/uswds/img/angle-arrow-down-primary-hover.svg");
      }

      .usa-banner .usa-banner-button[aria-expanded=false]::after{
        background-position-y:1px;
      }

      .usa-banner .usa-banner-button[aria-expanded=true]{
        background-image:none;
        height:3.1rem;
      }

      .usa-banner .usa-banner-button[aria-expanded=true]::after{
        background-image:url("https://www.ncbi.nlm.nih.gov/style-guide/static/django_uswds/uswds/img/close.png");
        background-image:url("https://www.ncbi.nlm.nih.gov/style-guide/static/django_uswds/uswds/img/close.svg");
        background-size:100%;
        content:'';
        display:inline-block;
        height:0.9rem;
        width:0.9rem;
        margin-left:0;
      }

      @media screen and (min-width: 481px){
        .usa-banner .usa-banner-button[aria-expanded=true]{
          height:initial;
          padding:0;
          position:relative;
        }
        .usa-banner .usa-banner-button[aria-expanded=true]::after{
          background-image:url("https://www.ncbi.nlm.nih.gov/style-guide/static/django_uswds/uswds/img/angle-arrow-up-primary.png");
          background-image:url("https://www.ncbi.nlm.nih.gov/style-guide/static/django_uswds/uswds/img/angle-arrow-up-primary.svg");
          background-size:100%;
          content:'';
          display:inline-block;
          height:0.7rem;
          width:0.7rem;
          margin-left:0;
        }
        .usa-banner .usa-banner-button[aria-expanded=true]:hover::after{
          background-image:url("https://www.ncbi.nlm.nih.gov/style-guide/static/django_uswds/uswds/img/angle-arrow-up-primary-hover.png");
          background-image:url("https://www.ncbi.nlm.nih.gov/style-guide/static/django_uswds/uswds/img/angle-arrow-up-primary-hover.svg");
        }
        .usa-banner .usa-banner-button[aria-expanded=true]::after{
          background-position-y:1px;
        }
      }

      .usa-banner .usa-banner-button[aria-expanded=true]::after{
        position:absolute;
        right:1.0rem;
        top:1.15rem;
      }

      @media screen and (min-width: 481px){
        .usa-banner .usa-banner-button[aria-expanded=true]::after{
          position:static;
        }
      }

      .usa-banner .usa-banner-button[aria-expanded=true] .usa-banner-button-text{
        display:none;
      }

      @media screen and (min-width: 481px){
        .usa-banner .usa-banner-button[aria-expanded=true] .usa-banner-button-text{
          display:inline;
        }
      }

      .usa-banner .usa-accordion-button{
        background-color:transparent;
        border:0;
        border-radius:0;
        font-weight:400;
        margin:0;
        padding:0;
        text-align:left;
        -webkit-font-smoothing:auto;
        background-color:#f1f1f1;
        background-image:url("https://www.ncbi.nlm.nih.gov/style-guide/static/django_uswds/uswds/img/minus.png");
        background-image:url("https://www.ncbi.nlm.nih.gov/style-guide/static/django_uswds/uswds/img/minus.svg");
        background-position:right 2rem center;
        background-repeat:no-repeat;
        background-size:1.5rem;
        color:#212121;
        cursor:pointer;
        display:inline-block;
        font-family:"Source Sans Pro", "Helvetica Neue", "Helvetica", "Roboto", "Arial", sans-serif;
        font-weight:700;
        margin:0;
        padding:1.5rem 5.5rem 1.5rem 2rem;
        width:100%;
      }

      .usa-banner .usa-accordion-button:hover{
        background-color:transparent;
      }

      .usa-banner .usa-accordion-button:hover{
        /*background-color:#d6d7d9;*/
        color:#212121;
      }

      .usa-banner .usa-accordion-button h1,
      .usa-banner .usa-accordion-button h2,
      .usa-banner .usa-accordion-button h3,
      .usa-banner .usa-accordion-button h4,
      .usa-banner .usa-accordion-button h5,
      .usa-banner .usa-accordion-button h6{
        margin:0;
      }

      .usa-banner .usa-accordion-button[aria-expanded=false]{
        background-image:url("https://www.ncbi.nlm.nih.gov/style-guide/static/django_uswds/uswds/img/plus.png");
        background-image:url("https://www.ncbi.nlm.nih.gov/style-guide/static/django_uswds/uswds/img/plus.svg");
        background-repeat:no-repeat;
        background-size:1.5rem;
      }

      .usa-banner .usa-accordion-content.usa-banner-content{
        padding-right:1.5rem;
        padding-bottom:3px;
        padding-left:1.5rem;
        background-color:transparent;
        font-size:0.9375rem;
        padding-top:1.5rem;
        width:100%;
      }

      @media screen and (min-width: 600px){
        .usa-banner .usa-accordion-content.usa-banner-content{
          padding-bottom:2rem;
          padding-top:2rem;
        }
      }

      @media screen and (min-width: 951px){
        .usa-banner .usa-accordion-content.usa-banner-content{
          padding-right:1.2rem;
          padding-left:1.2rem;
        }
      }

      .usa-banner .usa-banner-content p:first-child{
        margin-top:1rem;
      }

      @media screen and (min-width: 600px){
        .usa-banner .usa-banner-content p:first-child{
          margin-top:0;
        }
      }

      .usa-banner .usa-accordion-bordered .usa-accordion-content{
        border-bottom:3px solid #f1f1f1;
        border-left:3px solid #f1f1f1;
        border-right:3px solid #f1f1f1;
      }

      .usa-banner .usa-accordion-content{
        background-color:#ffffff;
        overflow:auto;
        padding:1.5rem 2rem;
      }

      .usa-banner .usa-accordion-content > *:first-child{
        margin-top:0;
      }

      .usa-banner .usa-accordion-content > *:last-child{
        margin-bottom:0;
      }

      .usa-banner .usa-accordion-content:not([aria-hidden]){
        position:absolute;
        left:-999em;
      }

      .usa-banner .usa-accordion-content[aria-hidden=true]{
        display:none;
      }

      @media screen and (min-width: 600px){
        .usa-banner .usa-width-one-half{
          float:left;
          display:block;
          margin-right:4.82916%;
          width:47.58542%;
        }
        .usa-banner .usa-width-one-half:last-child{
          margin-right:0;
        }
      }

      @media screen and (min-width: 1201px){
        .usa-banner .usa-width-one-half{
          float:left;
          display:block;
          margin-right:2.35765%;
          width:48.82117%;
        }
        .usa-banner .usa-width-one-half:last-child{
          margin-right:0;
        }
      }

      .usa-banner .usa-width-one-half:first-child > :first-child {
        margin-top:0;
      }

      @media screen and (min-width: 600px){
        .usa-banner .usa-width-one-half > :first-child {
          margin-top:0;
        }
      }

      .usa-banner .usa-width-one-half:last-child > :last-child {
        margin-bottom:0;
      }

      @media screen and (min-width: 600px){
        .usa-banner .usa-width-one-half > :last-child {
          margin-bottom:0;
        }
      }

      .usa-banner .usa-media_block-img{
        float:left;
        margin-right:1rem;
      }

      .usa-banner .usa-banner-icon{
        width:2.4rem;
      }

      .usa-banner .usa-media_block-body{
        overflow:hidden;
      }

      .usa-banner strong{
        font-weight:bold;
      }

      /* USWDS */
      .usa-list{
        margin-bottom:1em;
        margin-top:1em;
        line-height:1.5;
        padding-left:3ch;
      }
      .usa-list:last-child{
        margin-bottom:0;
      }

      .usa-list li{
        margin-bottom:0.25em;
        max-width:68ex;
      }
      .usa-list li:last-child{
        margin-bottom:0;
      }

      .usa-list--unstyled{
        margin-bottom:0;
        margin-top:0;
        list-style-type:none;
        padding-left:0;
      }
      .usa-list--unstyled > li{
        margin-bottom:0;
        max-width:unset;
      }

      .usa-prose .usa-list--unstyled{
        margin-bottom:0;
        margin-top:0;
        list-style-type:none;
        padding-left:0;
      }
      .usa-prose .usa-list--unstyled > li{
        margin-bottom:0;
        max-width:unset;
      }

      .margin-bottom-3 {
        margin-bottom:1.5rem;
      }
      .margin-bottom-6{
        margin-bottom:3rem;
      }
      @media (min-width: 480px) {
        .mobile\:margin-bottom-3 {
          margin-bottom:1.5rem;
        }
        .mobile\:margin-bottom-6 {
          margin-bottom:3rem;
        }
      }

      .usa-sr-only{
        position:absolute;
        left:-999em;
      }

      .grid-container{
        padding-left: 15px;
        padding-right: 15px;
        margin-left:auto;
        margin-right:auto;
        max-width:980px;
      }

      .grid-row{
        display:-webkit-box;
        display:-ms-flexbox;
        display:flex;
        -ms-flex-wrap:wrap;
            flex-wrap:wrap;
      }
      .display-block {
        display: block;
      }

      .display-inline {
        display: inline;
      }

      .display-flex{
        display:-webkit-box;
        display:-ms-flexbox;
        display:flex;
      }

      .flex-justify{
        -webkit-box-pack: justify;
        -ms-flex-pack: justify;
        justify-content: space-between;
      }

      .flex-fill{
        -webkit-box-flex:1;
            -ms-flex:1 0 0px;
                flex:1 0 0;
      }
      .flex-auto{
        -webkit-box-flex:0;
            -ms-flex:0 0 auto;
                flex:0 0 auto;
      }

      @media all and (min-width: 640px){
        .mobile\:display-block {
          display: block;
        }
        .mobile\:display-inline {
          display: inline;
        }
        .mobile\:display-flex{
          display:-webkit-box;
          display:-ms-flexbox;
          display:flex;
        }
      }

      @media all and (min-width: 992px){
        .tablet\:display-block {
          display: block;
        }
        .tablet\:display-inline {
          display: inline;
        }
        .tablet\:display-flex{
          display:-webkit-box;
          display:-ms-flexbox;
          display:flex;
        }
      }

      .usa-button{
        font-family: "Roboto", "Helvetica Neue", Arial, Tahoma;
        font-size:1.06rem;
        line-height:0.9;
        -moz-osx-font-smoothing:grayscale;
        -webkit-font-smoothing:antialiased;
        -webkit-appearance:none;
          -moz-appearance:none;
                appearance:none;
        background-color:#0071bc;
        border:0;
        border-radius:0.25rem;
        color:white;
        cursor:pointer;
        font-weight:bold;
        margin-right:0.5rem;
        padding:0.75rem 1.25rem;
        text-align:center;
        text-decoration:none;
        width:100%;
      }
      @media all and (min-width: 384px){
        .usa-button{
          width:auto;
        }
      }
      .usa-button:visited{
        color:white;
      }
      .usa-button:active, .usa-button.usa-button--active{
        background-color:#0071bc;
        color:white;
      }
      .usa-button:not([disabled]):focus, .usa-button:not([disabled]).usa-focus{
        outline-offset:0.25rem;
      }
      .usa-button:disabled{
        -moz-osx-font-smoothing:grayscale;
        -webkit-font-smoothing:antialiased;
        background-color:#c9c9c9;
        color:white;
        pointer-events:none;
      }
      .usa-button:disabled:hover, .usa-button:disabled.usa-button--hover, .usa-button:disabled:active, .usa-button:disabled.usa-button--active, .usa-button:disabled:focus, .usa-button:disabled.usa-focus{
        background-color:#c9c9c9;
        border:0;
        -webkit-box-shadow:none;
                box-shadow:none;
      }
      .usa-search{
        font-family: "Roboto", "Helvetica Neue", Arial, Tahoma;
        font-size:1.06rem;
        line-height:1.5;
        position:relative;
      }
      .usa-search::after{
        clear:both;
        content:"";
        display:block;
      }
      .usa-search[role=search], .usa-search[role=search] > div,
      .usa-search [role=search]{
        display:-webkit-box;
        display:-ms-flexbox;
        display:flex;
      }
      .usa-search [type=submit]{
        background-image: url("data:image/svg+xml,%3Csvg xmlns='http://www.w3.org/2000/svg' width='65' height='64' viewBox='0 0 65 64'%3E%3Ctitle%3Esearch%3C/title%3E%3Cpath fill='%23FFF' d='M62.672 55.618L49.48 42.426c3.18-4.59 4.77-9.706 4.77-15.347 0-3.666-.713-7.173-2.137-10.519-1.423-3.347-3.347-6.231-5.77-8.656-2.422-2.425-5.307-4.346-8.652-5.769A26.606 26.606 0 0 0 27.17 0a26.61 26.61 0 0 0-10.52 2.135c-3.347 1.423-6.231 3.346-8.654 5.769-2.423 2.424-4.346 5.309-5.769 8.655A26.6 26.6 0 0 0 .092 27.077c0 3.667.712 7.172 2.135 10.52 1.423 3.345 3.346 6.23 5.769 8.652 2.424 2.424 5.308 4.347 8.655 5.77a26.606 26.606 0 0 0 10.519 2.135c5.641 0 10.757-1.591 15.347-4.77l13.191 13.153c.923.974 2.076 1.462 3.462 1.462 1.333 0 2.487-.487 3.46-1.462.975-.974 1.462-2.128 1.462-3.461 0-1.358-.473-2.513-1.422-3.46l.002.002zM39.345 39.252c-3.372 3.372-7.429 5.057-12.173 5.057s-8.801-1.685-12.173-5.057c-3.373-3.372-5.058-7.43-5.058-12.174 0-4.743 1.686-8.8 5.058-12.172 3.371-3.372 7.43-5.058 12.173-5.058s8.8 1.686 12.173 5.058c3.372 3.371 5.059 7.43 5.059 12.173 0 4.744-1.687 8.803-5.059 12.175v-.002z'/%3E%3C/svg%3E"), -webkit-gradient(linear, left top, left bottom, from(transparent), to(transparent));
        background-image: url("data:image/svg+xml,%3Csvg xmlns='http://www.w3.org/2000/svg' width='65' height='64' viewBox='0 0 65 64'%3E%3Ctitle%3Esearch%3C/title%3E%3Cpath fill='%23FFF' d='M62.672 55.618L49.48 42.426c3.18-4.59 4.77-9.706 4.77-15.347 0-3.666-.713-7.173-2.137-10.519-1.423-3.347-3.347-6.231-5.77-8.656-2.422-2.425-5.307-4.346-8.652-5.769A26.606 26.606 0 0 0 27.17 0a26.61 26.61 0 0 0-10.52 2.135c-3.347 1.423-6.231 3.346-8.654 5.769-2.423 2.424-4.346 5.309-5.769 8.655A26.6 26.6 0 0 0 .092 27.077c0 3.667.712 7.172 2.135 10.52 1.423 3.345 3.346 6.23 5.769 8.652 2.424 2.424 5.308 4.347 8.655 5.77a26.606 26.606 0 0 0 10.519 2.135c5.641 0 10.757-1.591 15.347-4.77l13.191 13.153c.923.974 2.076 1.462 3.462 1.462 1.333 0 2.487-.487 3.46-1.462.975-.974 1.462-2.128 1.462-3.461 0-1.358-.473-2.513-1.422-3.46l.002.002zM39.345 39.252c-3.372 3.372-7.429 5.057-12.173 5.057s-8.801-1.685-12.173-5.057c-3.373-3.372-5.058-7.43-5.058-12.174 0-4.743 1.686-8.8 5.058-12.172 3.371-3.372 7.43-5.058 12.173-5.058s8.8 1.686 12.173 5.058c3.372 3.371 5.059 7.43 5.059 12.173 0 4.744-1.687 8.803-5.059 12.175v-.002z'/%3E%3C/svg%3E"), linear-gradient(transparent, transparent);
        background-repeat:no-repeat;
        background-position:center center;
        background-size:1rem;
        border-bottom-left-radius:0;
        border-top-left-radius:0;
        height:2rem;
        margin:0;
        padding:0;
        width:3rem;
      }
      @media all and (min-width: 480px){
        .usa-search [type=submit]{
          padding-left:1rem;
          padding-right:1rem;
          background-image:none;
          width:auto;
        }
      }

      input[type=search]{
        -webkit-box-sizing:border-box;
                box-sizing:border-box;
        -webkit-appearance:none;
          -moz-appearance:none;
                appearance:none;
      }

      [type=search],
      .usa-search__input{
        padding-bottom:0;
        padding-top:0;
        border-bottom-right-radius:0;
        border-right:none;
        border-top-right-radius:0;
        -webkit-box-sizing:border-box;
                box-sizing:border-box;
        float:left;
        font-size:1rem;
        height:2rem;
        margin:0;
      }

      .usa-search .usa-button__reset {
        background: white;
        display: none;
        margin: 0;
        padding: 0;
        width: 41px;
      }

      .usa-search .usa-button__reset:hover,
      .usa-search .usa-button__reset:active {
        background-color: white;
      }


      .usa-search__submit-text{
        position:absolute;
        left:-999em;
      }
      @media all and (min-width: 480px){
        .usa-search__submit-text{
          position:static;
        }
      }

      /* FONT FACE - Roboto */
      /* latin */
      @font-face {
        font-family: 'Roboto';
        font-weight: 400;
        font-style: normal;
        font-display: auto;
        src: local('Roboto'), local('Roboto-Regular'),
          url('data:application/font-woff2;charset=utf-8;base64,d09GMgABAAAAAD8UABIAAAAAkDgAAD6tAAEAAAAAAAAAAAAAAAAAAAAAAAAAAAAAP0ZGVE0cGkIbmjgchBYGYACEEghUCYM8EQwKgdo8gcJOC4NyAAE2AiQDh0AEIAWFFweGfAyCSRsdgRVsm1YzOA9AqOLmUDjhjoeNA48R3rWMDAQbByA9yMz+/5bcGANu0OoLVgkiKgibLUwmC7PZaAfW069bVrtCnvyhf96rUZyIA+vlhqnQlMFLNfy6PeLzw82/ZQZ17xOVFHmh0uVz6zaM3cYyTVxEzOhSZ2DbyJ/k5OX5qI7+OxGZWdXPA8hrkcu/GsE7AH2HaG73K0aPDYkcIFhkxhhjdA1GZMqkN4MoQQVEwCi0sdPv1VliW7bjTBxSlKyD8PcIu+37q7C6Cjvg1wOPFlP9zDlQaWmLeCiQFJ+v1jTg/l/ouMgYnbR6765EwqPq+DpVowh2OQRHOq0ZWTLMaK17IKi5vaseaLUr27lL2En0wIJpVnEnJUXzBEV7339HpWQH/tl/vPSPJLdG58IpVrEnkGMKQsFnvIfLtJE0amVrt2/PTq+IBcAA+oAFwCBoAA1gAHz/c7oiHJKjLfwc2BwenZS5/mcu4XE7Tr26Ih3GYNJp8h0bfK0TiNbGthI+F6n4bE1YGFlw6q4qbpyChsz//7XUzt07sxR8CcufslzhCiSnPXGNEosnmf2ZAs9uiSaIqsCkyq6SSVVG1piqyipr6lNr1qur6kmO0QG7OyFJqDPyhOp53ZOZdE+SCS1gaClZnOQIkhxk9+gjOlTgPicfiSSwkMhCSEYh1ff/X9WyfRcYcofUcKX/NxdVCkX3CWyQjrYMdlVST6Q+BqCCCThJG1KsPA9/AvExCaIj3dAhhDbHpnDTblHucdFWhv7d6dsBfsEDoBYGVguCgOIsxqYHTy0KsRk8MeenP7XvLJGx5tWcwEFm5uOny8Tp+vM3CwkrRves7U3BGwFC8oggIWu/J/tj+j29OevdbveHihMQAgED2J9CAXz3nRdFA8Bn/sR1GfVnlePfAASGA3AhwKXAwEEegzzxHMwL30EQgAYUGOA44HQgQIGkgQBHOQuEuNFNrJ2BwANTyAQg9VBySBRQfFRAPBHoQgD3n73f9KxHPphMBOggpRQCDOjNMm8CGu/ljf3NNOvUqd+cS66649CrGq0Jd2qulupWvWq2Pk/Ld2STuqQrgXdGScwQGqeH8bC80N+loPKqw6nuLKDluyQ8jJNRbx2pOvF7Ieq5BeKFFYImblqwdPDoxAOCCx6cRJa55z2vPATHnucM8kVA4kGKjQ9jmXeV4a/Iw4QH1n+fZFzJHv6gjptJHjDLa+YDLGAFJ7j4rnnO45TvmZd8oPLiKh8FKEQRKKonD/SiD/0YwKAazmsjGMUYzmIaM5jFHOjqQl65iEuYVwt5aSl2Na9dD489HLRCvLLY+NVeMO44FKcDknr2aeYprbyhk/s64SAY0Jy3CXbGdgcaIre4ZppX1hEP52TmpOLYGEq58+mCwI6bAa6O1scC4ABOsOF1bw4cWPK4936ObDOAZZlXXHOL+5zk/ywxZ2XmmuJ0Gsqi81mwnxsmD38GRTbvaHi0og3t6PgcZCc0vFAwWGHM6I5llpfMAQtYwSUZhTM8OyMCoxjDWayqNRjb2MEubuAmbk3JyixvmMMCVnDBMEYwijGcxer74SxxcqfICxcUp9SZBmYwiznQnw+xxA4Jk3zYAdexh4P4CchCA61oQzs6urOyhmcH2Pd2Sja3VBZ0Z3p3ZgRmMQf6fxHEHAIKKzY4kk446ZTT5MhTokyFKnWatOjQpceCJWt2HDhy4sqdJy8+/OTJV6BQEYoSVKXKlKtRp16DRk06jRg15qwp02bMmkO3YMmabTt23XDTLbD9XxDAut3WSwifZsEZjMuTPFVfp7cirxdrn2W/UfkqR03NpgjwvwL5EpJ43VbeJyvdgOMXQLn3eSBD8os+rtwP0MlR7pvhqdK42/x2tizvGw/rOeBMQof+eHDkF7mH+qqVtOyRfqRDfz449KeLjUK7F9GnAtTtEkf/KnF9n+dRjvIsE880t1h6gfz5PMmtMBa3053ZvEknLtis5XE+YAfIEa7IwOYq3x2kLU9Tg6935VwqMgc4HUxKs5K5/iTOSKWtfMEAjYzae9ObXpsU5d5iL5Z7m1T9gqtfY+YeXcnJ7Gof+RPpA97M9t70A99qzP8WbOB0J6WgKKTVE5OYrzhl9KOibYgefuRso96Y/lc9T6V7cE9JWjYP34YL4cPTwoldEQeVXTU8kuX1lGzpB2iNhXJn8zJGtr7Nfh7SDE5GUnDIlV6jCNeew21UuC+Peg8WfzdPMx2O5Cu5I3o7+ruqOdj10m/qUG/hxSq8MCIIK4IkBUZK+J0QLicFckqQZIWFnLCSFx5KAlEWburCTkNYaIoALeGjLRg6wkZXOJkIiqkwMZNjLATNWiPciIfgBIFzFiauguMpzLwFy0eY+cZyyEMBUxLLhaocUs3LIXWaQFp1YPHyhrPpMQhlGLHHjDgLbSoWYRod3IIwWxQmS8JsTfO6IY/XdWhBd+Tx2oMIOtCCzmkRL5zkIpfHjUtkeUAtwK1RkQdzRgiMrPBSEhgVgVHLckBYgIXMPEYcOclKTBI83wLESmgINsKJ8OBcIBA3YeORRUI4NzTRHjsSNA+QRGkYeL1hWrSAxWQmK5jiIER4HOMumIfU6NBDW3kLzKpA1npzuWYLD5zkIje5yE1ucJGPgJCGAQn4z52CIE0ZM3W6sEyY4TchCkE470zEbCgOibyv48LhxOgmMlp10hGFhjDP09l4INqJ29e72rbHzYFbfN4zzXvWP56mZsgS+q4KUva5spiufw8TPNC+oaNzKL2Jo0GN5a3trGtlb2PgKnews/Hu5GhVSRHRXAiDzFhw2oWwPx3/2Ac9JiYaSP0PPqOA9KMiwgKAavx63UfFBBGA8WMSosnAkoNWYID7fXmgiReBmODjKEww+OCdJE+dfuXaot67q30sdwWVk6DK4kFFGjGlUHhB6gqI0Gg0GBQOzzzh3jaegLFpnJ4ln4u9p5Z9khUvr8WB37pYrvUSxOMmbAwqPeKuu9W/9EGw11sAiyMvvfDKa2+89c57H65H82v5UboEiT757IuvvvkenPmYZ69KSGC9fikBdd5janxTaOO7DvfYU4GLAm4JOB/ATW9rZwb0gfzdwD/gIXtzAzzoLQDzGosGOB84cA+hgORxEZH9MobwAXA1eAh8gBMy/Yc25dQXeq3v9L3zwfBH8MfwZ8IL4EXw4ngpvBJeE2+Mj8ePiomLY//9//83/4HACXidpVCORFPOiOfDCy1cEa/xmY3MtzzNcqpDPmT5V3//8H9d3h5ePlw6XDxkHM4ezhxOHtIO+w47DxsOww8VHl54cA16BJ4CCBzqEQVwByBsXr0lEQAfiWL6uNT1wanrK5S/QcTEJY5LSp04eer0GWkZWTl5BUUlZRVVNXUNTS1tHV09fQNDI2MTUzNzC0sraxtbO3sHRydnF1c3dw9PL28fXz//gEBQRCkprW3q6O3pG+gfHB4dGTtLGz83MTUzPUufu3jh0jwpIO7BoZH7Kd2xhAdJUaD4DSAeeNhjAcCjnwSGPpwbHAMAj3nyQVBeYePK6rWt3RvbOwxL7v709h0APP6be6DgRfnl1Mqq6or6BlD3pvbW5fUNMgBfeAIAXEKbbCWS7Qlmy1MRf66UW9sFE8qtAM506A+4uwV+iGGd18A9y2AWDffG51j149oWcGw/hAI4zcphhWDimLlcEv4f7mEcWH5LDQaRvRjwo6EA7pWGBYpgVVGfC0IudePepRGdN3vY1VHNXqKDu0sEWvlCoI0VRPzUfhApa9g0nLblboTpiu28qjTTX3PQOH6r7nKPoY0PMbKTUmRhvpthjK+elHwuf+pcc7tkOCWe5fZk+sTGQBtCCbrdm4kUFLRu8l0hz/Mwe5kwJXNJBFZlTVB3Kw09Cj+md2os8T/HYzQCNAZszaG/kuYQaK0kkdLdYjHiJvUmt/JXPLRLfHoDf6mF/0jioxgw0veX9ooQMJIAcl2WkAHPu507BYzPyZJTxo00W8fa0GD570k7/nXa9SfAP4ETvwDO/AwARty/n9t0pYcBZCj7ddEhSHBQIeyowAScPRV6AaEJz+QL+8AWFFJgyvZnA3TtqREC+CA+WPxMOsR6KP4wLAd7dmTcRRZcVDdBt+emSSP0CMBdOJCbB2QYyR5s0V5Ha4ZWjlWQPHSuHa3/D1BzPuLT4F3ARTue59FpNBiCbE+Lc+Vla0zrJaLs9HuvWFR6csaZ1WFyIpo8WF37qE9VyMJpo1BJxMVEOydbq7q3OWpvPM55cskmG846k94l02HXot73MTaI75LWY4yjETHVGp112JxYWBOlD51JLAXXah30kydWzQGNqZVOFlu3uRWdRQRaHd5PgpR44xVih4g1Nle8a2Qwp8WxdLK0pnBZkBAkymX/cJiuRYeYjudUcl79N7/up/6ThGa8+cP/UahaCNUs1AM5GcVAfrrGnLpUbJaMlVhk6Ago7ko1gqN/bReHGghLBosINyIdUW4IcimqGeM7C7FZJaPIyxPU7RiBSfOGkXhWkbaDIDcUK/XuSp8OxGRapHq52ZS95/rLKF2yK8Fiw7/j16u4sHGriT467JJe5vNbp6farGKGlZ8b29mZbNnNKSfb8cZETxMjCkKPeiGqHk/MmCodZkdhJSMgOfWYhOVIqfYpLoIb62HdBbXH9cnaiEYb+B7fdIlTTuJA1SptudmJhBm5QLowTFKh46WUcP15NSQM5FFvjMK5Cp5eX49gnPQSW1ypZsNdu1OgGl4WoBZ1wzJbxMVue63+9gI1S3KVuIQ3SEdc/uvKVORTwK6T5dTRWW0HsKwWVJfx4Gi9QciH9q1GLKrYnr4DJQqwFT7rZT7EAnKcry4+K/aglXSAbluJfqVapTozp00iaqvitRa4E7jYhvX8VLf2b1T1Wvy7cpvPZxfx/zW+OMtbcKtum/06vcZYPUvhgj5V11iUFKN06CubWDRbCpxlQmnndLzt7aBRdBPTkqlWAGeMgHkZF2cxOP1Hl0NuArFyI2M/gktyA4y9SJp0o/4FvEw0uNgpCuu8od5J5K1eiLUABdfZ2I8CViYS4iHMXKkTbKY9u5/xxwVts65iKfjvEqznVF49FRMqhwIZIxt22o9ZjbwZzMLp6dSVYdNOI8o1gJuTiMTQ/sOkN/VWSzLpJGwWOtQSqA+APr0XmZLV3twWjAFoT9CICxIWJCHeJP12rS/XWzPgfvlp4eA94ZxKnsdWuBiRCRidvxyS8v4BHe5TeshZyrlPQcnbN8CNaDIrglDBEIqSwsyiihBZ7AmlfECFOWXQHt/wWdbXuhVzKqskFXsugT766dgGxEVCSzi+ejZvVlICEu9Ns2iNDVrAyHioYITWq3DJFHBBnZi+AgVK70a8M5dcFiDHNneGNm4fatQRLpkHhGxB1Xv6OqUEA/VvPVbxIWOXMzAtsGglWdUnhz4FAzgF3SdhRSOe2od9eNTU+/gjnnvEmJzIuf6k9+2cdw7IvCLxqm68RslZ4UQpBn0aNWT3EBytixHfADhJaIstR1x2ig+KrkeHr40HmrouOI4gJNf7YRhWX8jz35qS04wIKuzobOIxkE8hOAS1pgWE3BOoIgH7DhllwEPaNigpv3BPikA6M6WB06T/XIqeVs8YvNKItSXPqPOBMsYb4IMlI1YVNm1cKatEBxx0LThLu2OLHmNVikUX2XYUg6uhbs0HKTE3Can5t3dXHmkE1zUT0GNquBnxrc1yvMvY+rKeX8c0dhDpG5F/EouGkKdQVE0UCBnJ2lhYVQlMfRRCr5EUqdJR12wcSEQ7d5oUhOCW3OhP+pAnA+4PKGBxYKUWG+W0EjdlsNXmdMECIbS6d2tmeyGf78QrOufdPnEQesBJNIFx0Xed/XuyusDK/6OlevEq/j9ZnMFyVZN91ZupDgEyDQX1ohJ5Ct2KR8e2Ezes4wWsW/TXYRrf9GiwrlMiqdQA6Kun6jIbXt20kowx8ik48sZavCNHThxLSDQb47zg+Vs35Ikz6tBKuKnQXbHGSA+BjJ1nrd+RQQozcSt4JFFA9RLaelWs7w6C6n5SYYhKfBmbUqBxm4eYf4dTqbP2FdJ3F0PcwobNU8xoCaSakkvTcbIBFZlEML4aleoaW0tB4LYq18lTDquuRWfzPbs7j3d29d7ONgJNIyS6KZ4IJw9zl8QJ2nRR5bzDtMS7czPKDD2Sia9u6hSNYIG+aOnoF+wvTMu41A/aKY5zO/EFnMh4+ewNA8qL9Jz5lh4ESFZSGOCBzjrgfI5gWs4Pat2drc4f/JkVlxLchu9Difv6Z6xtmnCyk7JRJ49dSn9dyeNV3v8FV1/m5uljCQ7IJQ6S56ZXRcIc/xow9qO8KSNPj/fCR9WXZLx65VlW9fGtAmQ04YznFtWU5EYbjlCS8ba8XtU/Mgu9dpzKeKWhiZQdaT206Jnqp75xDi/7EqW7tIdzll3YofmeNRJLyGVgO926VG9d7EQwaaHYMnM6ktDUo4AnM/Zpbx9aTaj2j0sWeVlULze/drzm7//J7zlCixAT8BoDlQzkFMFSD0UEq3rkSFKzstqby4K20Z4V7lGkQdi/iUZ8nUYji/E+CPuRzZvKIs2PXLOJ2imMuxTgdLbBfEW4aB8xEBCGJuUd7j0+mykIdVu2Q9cRUOE/5QI977akxsdB7Stn+5SGGGWuC3Gs+56XNlBvgoo3Mq1/wP02/9XfnIHG82xwdHEZGzG6T35nPt6fjhWApK3AQ7wBkokr1yTxPWvSky445EOBfOCxns0DYO/YEludkwyBkO6ZSoiU53JJFg6JAW9L2YuOnfn/NKHtmio+x/e+mNk4AEYVduioGAiaVC5zlfrCOOBR8e9CpLJNHK0eo+gqlZwk7+yMRsU9/aWdrt5L1/txd+vuDfAwXl+bKyvoIydlpBJD85PlA4cT7dsihzavzWDna+fpmN3na3RqVV1hXl1GBKq2Ma9/KK+gd5hilt/fn5M71E8tRtm6BVuauQa4WNi6hNS6hDhKTMrl9Q+iBgaoZlIgmgcg7X4EmbsEuljauQZZmLkHOv/4FG4gHU8ON0gPLoyIH++N908wqDDrXz4/WL98tsDdvZboEGlrlGuU0zHwvxzY/vHAn2xhsGYctg89OrCsSYkJHGTqT81NbCyDSTzzT6hIcDSSU3DVNQpyt3b0IxZx7ldxx+SAB3WYfNvHyR3vnbJNJFOqYhhX0ELAObdU0Hko3k+SlG+RPPbaiVnV+GF84wePPHMpUlMC4wMki991C28VDrCTIuWZv3NJbGHm7rkp4yFTLxODdmti9j4ZLdOg6LnKkeZDF53kS/fEn3rCXj9ef5VxNfwJNMQQLBALN/PJhZcMTFeFBG7wsYm8bHiJrfCXryCPy8uOkcuEaOkdUiiZdpx+d7TJfa03Rw+V4YrfDe6rvX19XxqmMcf2Ou+gojxnH7p/8g3lkFqcfwP2ROs243o8ZZBrTVhTiVHwXS4m07ndhVxcFVfS2FpK34B9v33l9d65m1wnC/rv2vEFKVJzoboCMvifl1Ni6WN/ni5vHd1e8ks9F3EmSTJ3PGvl/6YZ3J9hxNUVZxaWUfOyWoqqIWqaesDRZsOmI8OxIfrk8sfVE5/XVzfdLK/dtth/NWJzpjRSl7J+hDp89Al2Z/HzPubCOCa9IjMxp3q8pbqdlp9irMwUrPz1XJv4Tfj/78UhOW/90mPWvUdf2Leuw/X/mlW7Djoirlf4dcSKuBhPdd1NySifrauvnHMwdDGXnDZfkqzj4268paS7ohxNHgqQi5XPP5908d/Dnd0/hxcSsy/GyvvLxQwR5l7fXFx4c5M5zi+1uelXfcOP6rK83JpyrmCB6MLC+Jh8ygP7XVNMDVZ6nK1h3Onkn8lICzmkVBOPrqRRbv0w5FUdsit0RBxvPfEU/vU510+f1lgJJ8uZticpqTWMprryBS8Mhikv9s+KklhatZJY6gqPTo+sYZehvmGn4QmFiZJa2CWVgNRqlYC0BZ7gJihRodjaKbfQyTc6IjoxIjQtyosOdT1em7m4u3luvGuIEGVu37igPXt/AjkRur6xfrzJO31eeUDFucTRsrzqBfYqR28y7FJNhEPWaTtdpVPY5zWx1IfISWy+aYPthtraZBLLV9bvFQSpheueU2cmjpMPripE/Ao7nOhnFWDF3p9Je/f+Z9DDsT79RyT2MvsGd21iiIQvWuZbun5C41uC9vX0QEramvgqbVB8n7Y6wf/++6DzEEDS7r19t7wQGtcadDoBT5nLXvn78KX6IJtOYXNJKpOIXpN4Zn0GIZlKqBByt8nZEngu8usdTDVWtfRKpRJz7/hLXhjP00W+sf6W+rkdzt9lb1d5JzqHKwUnzegeT8sliYF2FXDZZ0s+QaX6liF2FWzC5oNvuP8uP15i9yEtXVhXEuJ+WxtA0mrab+wlOWgv5QXlLQAkrbB97VOQoc3CvEUEOpw2geuvV4I2sywUI3ieHnspsr+gghdfXOMAIPv6ED9P6JIzN3NoxRDss8Fi14OuBYCkLZAfkBfDkn5fQWH5adoi0/Vfr6/f/nj/8kIGhZqbVF0HCuUEes/Nvak/zZ3C7ZfauVI9Ms/jI1on2uLS5RZPCRyjCa/0fsTPqLgaV5Dw05Ya4b1GrL8ahvDoKimzFxi4eOXtKvMlLGze2r566KBCl2mANso8WK0OXYvYrTJgGR4dZxms0N+/BMG3uc/P7HDDvkb93hWhM65wwP5ohWtoMnrT4H/P8XljD/30u2urR3NPZXFuT0s5LNjOHjt0o0A+2QV+JTdZ8bMZlz3VChrLkFxpfx5AV3kuTYexXzui8Shpd8na1YarHzOPv6EfHlCqN3IVXCLYtqqOTlQM1qQXdVY0AKkgF8o308OtxlHs4b36V3HZV1IW8wfqm8rb02M86lMjQ66mBvbEnMPtvaiHk0vXsxbzlxp7GrvSDurigy0SsHsAiZ0HSOyN9lA5yz7aA3ANIO9yir0XhKBHh5futI+d7eoZHWu/q1PyTwBxbldslTYsNk27rv54U3D+5CgW/qObq+bHiXGRZQ6Jp4s8x2jj2BVJHiIPERcvOc6DpC14nDTK9ZZ5fOX6wf2nIWphak9u3r96/VFU8F7anTuiQVWiC6Lhr8Z7CuqtBm3HKxWe5nK1fy8zxU+/nAcoynxjCmCaSzkOK6DRpFAyNByoz04FTHOpjYsARVk8IdB7/uKj0dMHWacORk5oZDfUNtQKCffe6YAkH0qc/M/skF0w2Xl1ijoEGEdTLgFx5NiggiAzhgO5fsUt8fwNBrznU52kG+ZLqVuLh7jZgyrndbe4gHRDGNePJ9IL12Iq0enDAAXoOjElJYen4HOIi1XXimfthvach6YKaq6F6uQG1SQxeYwjvBMGVoKI9xFSQLQ97uutotqZD7eZxsaZwssLI8qaNxckzjdtWPlK/nwtO3+JmKNMBygwjI4jFq1deKP0Yw4117BdSLNv++jYOEppuB5qjbuHw38S70r9c68858bRMbjNfXjHxEpJYJGdogHJrWgHG7dJaujmqhbhYCotaia8GBmpGIk5S784rH/IXPdSxTMgPJD8ouLFSIif5N+j04trRCo6aQi/++PjbsLDIE1XP2Ji9WhRfUOJDzFr4dIrBfqn2bqdonGH9nfOzcNFDdcLuZ1mU+tX3WC5V+hXQXx4TIxnkZ+kDZwOUIBu6ULXpK+LyEQTMjzTCFF63FOas+qCOgq135V19Q2dzmNFpIkqqtXpXlb0L3HJ6QSluwIT7YMe9S7vJ9xOcCl8JAjjejURSYnUzScOYyo2o36JwcjkffpmfAQ5I6wolSVsi7H65sWMYTMPXTMZN6WJLEpruczNf7Cazp5SHel/HxRX3Mco/GNvT/51SK2+h1H4Q0dP9d8uLeu7tz4xeK+0eOC2icFjru+PZBZXSenMdIC8M4ROIlE3lh9Loubgsy03KINOtUjHmpGC1l2Sr+T/o5OrC8RsJsIwQN6hI2KSGCsv5f/MMTFabxT0uVZh3cq7C9v2ok/F1dYrzOg3A7rmFCzds3JA9aKZvJioFcmRT6vXyTbOvuBwdnzu6cVahnV2dGBIrJuZUYQRt86Ii2OyW9WLs/TcdS9Srz8d4V1CIEdkOgfzJeijNis2OwxU9A3wafXmOJP0jLqSjtWKVVSAYnZUVOb1sanLYGWBfv7b5T2TNhxdk+b84RdmWe8in7FmGV++5kV1487/Cq5Fx01p1mPilDFw5Xpcr+Ycu9NpzuXTdf7fzr4vuRXAQxA/+Fn7s/YmQTyA58DpLQfn8pk1QeVHwez3xI3Z6nG+4VZiwSej+Y7Lblpq1Kc0eFEknfitm5TzTJOiaQoTTy+sf96r2vu0A82cPZxQlCTvGApsPul37/d4tgXDXjNQNGKvA6hLdTjsr019FPO9F1NOUw5HVwR2DCXJNIVzh2Bu9/1e1d7nzQtTj84qKNp+Zm5n3Co2z1IerLGQOG3rFOnbCXXOXqNaU/XGO38uWvvG+RkPjQyCPe4ltjprrXuDKFnkBtckM7mPIzNWL1fwH9FfTYitC96T2NsQouEf0x/W8czfQNbZ32OwecN5IZrpbrOO533Qim6zSVbIhfzQTPf62jrR8PUvby9fun/j3HxUZlpMRE5TBhqu15Zl/IHUnnd9uz2noCinsKQ0rGVzK6a7uj6nqLquLWl5pT25tiGPUt8U3X1lJaS9vCKvSBOWlka+sZzyeDmVtJvmvwJXkkmxy0nkGwZik/xK9fvEbWSGcZ9xurHhoqFuum6fbgYTcftWbDU7L4P3MuMbg8+savwi3dlY3qwoeBC+9pR0Wc1EvYR0jQ7lTta3Uvri/T3Kwnd0puXmid7NMYxpNwN506Lgfpb1By/hj67RMwaaqeWd5EATNbtCfRG7QTOSv0a2yLAHr6WAHdYy2MRUxS7fQNCBZoNzCjZxLyHko1y89jGQZtnYabn+X0HE5JNL02hne9uF3Rki7dJuS+dIT111kK+zl29UcVpsclSxr7e3U8i/vNGO49g+fa6+juOjw21i2P6uTlxvuwR5aJPhYbmWbbHG8NhcnXSz3FlbtdyadmuKWDjnYuWSnZSTFhbTnzRKUC5KN7FVUepkDRvJKS5oKi/UDuC390o943aCUU5yBO66Sr4xWo+SGOiCLj1Bj1sMg+Q1Dk6qsws32Co2OtKKxyU/gea/OJY5cDcN5makZemnKIAmHVckpuoGHc/pR4aPZ7WaQW4GqhY22sElY4rPeDorOvnRxxfCa1siw6ubIyKr68Ij6ur+HVO1MNXQtLBUVbO0JVhaKJyscSU0ENoH2nMactoGuLk/GzUamQ83uxHO8BNCTBT+aFuZWmm0kftr0E2ZxPDISCfb8coKV0xtqLOlmba8zJGphqXiqbbA7tT04pbkcDUTTwO+2pMVkUPplPy+jKh2GVstI1NzLaXYFsi9FLcGDlkl6ySOKWumgO7Qlvh1nQY8Q3MATfYuHK6xN99fwi6IQyHa+Tn678E+87/n7ABJO1N96x3J41juLLmcV3iyUaA6oINUgYq0c1WSk/4ZgBYtMHzX3OZxUz07MB5rwNQb1H5+qbnl/EK/ZQdjUfniYl83Mtg/1tnJlxxiG+Qf6+TgFw35G2IwGKsBEHEy0y9hdoElkDs6jhwdnE7yokOdh1dmV/YvT451nCWQDGyqF7QNyC8jrfwe3K/Lz8ubQAJxHP7KV/0fqyFps42TuAPbBvNj2EUXruTLIvfSmpEezvXmhYaFLC9z4smmP3834lzgB5LU4aM/EdwsT8jd3MLOzDYx1dzWPNCVRlRYlvZvn/q+7URHch38m8srnl+cD3fysC7wQU16aG9Z+z8KA5LU0Q/6ElAqYUQJIfbv40oq2LPPqOWKO8V66qV4czJ8WA92HiRNkrfmbnjiYuYS0/MnWA0GQNLoF8SPlXfUJ6d11BcBD2O6287WK8bUykRHRtamiZKl7/kKlyLrjs1zMw5TZ7xON3MWnlGJIvk4Klv4Xah2LXbwKNly9g2LdL8jGQXPw932kBtZNKnv8sinbOD8aEPb47H7D12iolPDI6jRDrPYio9T5+PGHRUcdW3HXCN2X4CjuFuo8bFLdbXJVu/0itqS9Uj15m0Wx94+jYeo0U42Ed4qcOW42mFMiYBofkH1JrwPHiWTYz+Ymnza4//crCgsupud/LCwJublVk5OT3Ks3FJp6e0a88D53DzPGXn19ncqZ0suZJsHofLYedlKzL2rui4NlPYvZ2c0Pppzlf8qhrvuz+ee+2loW2KMXAZ7M3zHnyWXO3lKdaT+OSypIPqcMq9JD7m61KTfnvb3IaUy3EXcojY9aPNq7Zzqkj/RdfqhecnA7ZCpGVei03i4IbX/Dj2E1x0akl31EWXqpKuS8pbQ5Q7ldWFoMoRJlcD+HDe5+28dlQMMq4yWYP7Wd6cP4UzfjPyaa0tC3DfTF4wNYS8ncBDGFp9CWxo3ll7V+0t1Jv+9QykvvhyvHaQfskwmbR/9fR2/hRrqWSm8kBRlkUHJ+1p0NUY3SCdwjVR4j0nu3xx6tuMmtbjjYGum81ZJUde+4c5BUF33sWIOgQxKXZN88DuWprqh2qEmtq+cJGXxhGy3tHgv79SE0dSUudQUSxc5QyMFeSODQENjBUUDk9NKz+4RUgu8T03664wKnWpXSENFJVN9JOL8NMREz6gbyehjnuMizLwzYdWUufhQ/3Ux5lqecDPvHFhF5WwuCPJfEysVCDf3zIRVJdKDQwI3REulw808KbBGOr2XELh7Ty9zLTJ6o/x3FNA9CDdijLdXLMFH0i062teHSHTnFZaESsuk8nBS+WUYjrjpSXUrlkNlUDmmOzrs0xw63v+ZcSpY4Wz40uT1vvgQMVxHknDyD6HjSNaJ9IniiYwJZqSQyOfIQhFcF0Gc2EvbRJ7PysguzqbqPBOjFitTKcWe/KSK8opyEr/nl/Way16Xax1yiboTVKMGIyGDQketz9s3t8Hytv6Hj5q31SykvAots/vr6yo7SqDMK9iaMxpZyn7eWp76sl7WG56bw5uWkwgEApxudwHHzZ3v9eI9vbVxkTSsLdKSrhCbFB4Z5Xu/4v6IBUOTUaCEDErDWV/ejdoNC3rLFzkRjM7Pngs5rQ2Qt+i+O+duldQIuUsEwfdBxYNfj4zKkWq6Jr0DI5tqN9AnsHYNYcRBeN8vye8Sq7YadzeMlVFbRkBHeU/zGLWsYQRqbUUtlBTAJyeXqPnwKXP0pjP5SRpvdzoqN2qobSgJGZKM7Eo7eijGahmTq1D1IN/n2JC+kGV2OSUlvaOyMKU/AxncwhyYY2BmaaxrY21pMRwsnieSx8UK8dwxsyYnFlYmxbc35VP7+xqUdu4/uYrIqFKyPsMp7uzorKdjY5tuauXQy/Bm9HtXr+ZGKZUYJiaqlmjmRXYk55IxHcmRhhb+vxJVE8PqEzIy6xMoq8o2Grp6lhrKKlYamVYa1PdqT+VlX5BeeH/L+Kp3I/2QxNLizJTujpzill5YzbVbS3H+WfV5AaltvqdMtZ1s7bS1rJyMDCxsfHA4DA7Dj8NIAew/ANcOsPk+4k53AmDzcMSdHgUwxwHmIuD2f/6dbge3yzj/zrABLqGHAcqdE8C/U5FAr/8yd7txfvHd4oM+/Q5e9wGwG/Ymdck4SHAVL4ZIQTWo10MRGP2KQrecQQpI7kwyLvlStSfVvH3dxqQNq6V5YZSfp9Xlsi8D44RxOpVWu/nOU53Gfpch7ElVYl9XWx5lhTJ24wzYk6jY16NfHhWSq2gif7tKSRPHUreUDnxE1eteJyEvSttUWlaCp10NgfVnSlXZk4phX7dSHuWLq8MihSadxvYBVCdV8A0bWH9MULbxCERG6sB2vrrsK1bXzMbUsyxkFbAsFjrvJIX1fboZMZZjuXMDxi/6j6Kkc6asu1wqvTS0K5odTQvc33WKkNuWE31NJ/2wTZo/1YPKozS6Htpctzzoanro+1FGg5WuD4eC9AlH3bl0AzujT3cT8PCHwPqr+qvaZwp9yIaLgO2DYOy5MrIT3TlevlN6YexUFwXYoht7briT0axkoIadcQevgX6DwRFea7223lhvrXfW+8CHnd9qPayfOh5+/I/bHf47uzel5wLwFODZ+VrR09ipwwflIt4XqmEEj0mSLdrs/b74fY0jeUxzAdbL1hh74IuIUb9f5wnV59y7qim+YvuNf6dK0qEx4tZaMQTMm+yG6M6UQ6CeBoO2uG+PSI5wE+zn7rMzcf6adbBfQGLeLOb9ajAvVLP9X2kD5vCuOmz7jROYH5ZG9B2MVxtA0Xpjrj538+J9aAx/M2354Ao+bwDx3ndkDaiHrv/gIdBXReT/Ni6F88++0VpRCoyfrze8cAdTeQMoWm9KV1EaMO5tIFFTPIdWcFoKCankJ0+ZDX17U2fZEFeJyNoYGj4V+vyGoy0jXfjiV+br3HJd2BTzV+o7J7YlNgCu0i19ftHYd1m3rbkYjTLGyxmQcPVH1gxNDn2wczp6dlh0VdeJIQ/NFpTJZC8wSjkAIwrqj3q2ABd3Q1EjrZ//F4AwVBuFik4tF49NSdWHpoi7Av0+yDOgxOBmtWEGC/sHKWz4+7/OLT/KxInma1/HIJop+W8BJIMRFFOBazukNF1Y+q0KPfp9TQXNT/hgQpmgu9qDV5oy8ZPsogVVQ2ItBbKUJ0pkZRuqE0DWFnbnwUC3NfZ071LRWeQ10ATHcZAeZiHpMzTT3eVzO2HhGJdB3rjb6gSszXDgYMkkpvtaA2ZmI3Mx28vkqNO0N2EZcOZ9Mknj1cHv5hJ/zTvogz6dZ3/ACDFi3EzRpq2w3X30mO79+pdms6lOu+44KxkX9eMuUnWr8n0wEhc5ALWNMywp49WWQbQsZ58OAJ7sIIEhvosrARCgZ9LcNJhywBSYomBcfhHRDLlNBvQSytUQJUCm0nRBRXUFZm7bwuwYyYEF7JsYYiany9ELeA23wo7gXw8EGWiKartFhBSZGmy07zkWoxKVxUTUpWnS2EVV/TQt+LZHh+5A0Ji+PwJ4+wgM/wrpfXGmX3OGeJAzv8IsAr25DFgVK9tDx9NInbG4zQ6YYreaeLNAQNqe53JAHpdyxTrEV9gRgATECoNqkRCRGy0bvCjBvkLxZMn8U0beKCekbW2xB0QDQT9pkVExzXMZpx8E5HPBSe39gCqorOwYLH36yQ8+oceTIZhicfSk4ro674xlT3Ws2YcE27Yo0oK9Zu0YsRz0ebuQk9vAm2wv0swoykXvxCw4cTbe0TpA8kOMey4mUCYZg6CgPzI4g2OmYA3W6WFrUjCkL1NINlvaIn+NECpTC/SgoOLl8GsRIZ42569XxE8K4I8xXrvlQbGDSe4zH3wPHkms46fVaY8ek8lLTl9vCMj2z+0QIQLRVaYBNVoDBsa1UKTd0Y1gasyYqyaEEJipnkgW1muBkN0sxS9iibmmmF3KLMTJi8b3MxwLU+Nbh/ALa6KtcWRNOAQJWgZHn2LmnmyutFYmWp9PMSIn7SSKZxP75TOch/p/TrBYtxr1o/79VDr1XfolAECOSg6A7D+uof81wR71vwj1/vF2Hv7oXz+j9K07fHQDJDg436PKZ88Nf5D1UrdhA6tA2X/ynbE0T5FSlcBTeA1fIYWfXNO+sHLuf3tONfjAlVASKeQhz/mIx4yKeXQPww5Yjp+0BDaA3XRhgSgkGxg2vkGukxWi54KDU1ZWYx4XtcRupiXfLbvU9OR8QhSWpdcpwJUjUJCMmM16molVc1ZazfukWh2ydgYVKM3SrpotfbaW1bXWPFSIn1tt9+ADfyRFJGUFcu/7awXrjcNk7NpiAoE1GBKmAyt9iUHPxfFlPb6v712pZAx6hJbARsoD7rTzLrWD9mpzYpHEUJaTFATEoWBWjRRIlT7YrYR2Dq09aVWIWVTyrs7HooF3uRl7q9t4IMdSJJi/8I4UvofwHD6CgeL/2xXzhFd8YZ8JcZ97pR1B9kvL2V7sBhqpNxoFJWnwJ9c24bCHoHL4j2BNClmO/k+IyyhH4U7rxGyWyuYxFkmkxk9ucpadw4JtNLysKBnxUkEoqHqlE9XOKyg/rmY79fgPElYjQzOziRICBNCl/Ylsw7Cw8atEDEt5TmguZPuOQUs31n5eTmBsQQE6K1FVy8ObfZ7qvbUp1O+CimrTgkp160Qk2IpQgWqCxGXEskQKeBMb1Q7rBVphIWz4KoFfMudnS7rs6TKi6G9DVUBZPsvEGyWg+pTeQ/RwHuL/rCA0qqRILEy9CgAvi72SbQGT8gEh82Zts9AGYb6GZzWjIi0hTe3L4QQ7lNYYZ4i2gO3YjlXD4egFMx37MYmZBoWwYv3zTGPavytT5RYtJKwUBDy2KoQwfFhZqqtquCjRqNk3fB7C9gkQwA4lbxrC3qpTv0wpBKe+U0dg0X2OYohvowKTDU8xEWpy0vipm8rcgqa9+vgvy+3olKPa+xaEDP+iJ7lQcR0SdumvnO9WhXKn/AtDNriXblpkvGEtM1Pa6ldmJetqE1AFNXM5LzjWln6r3KjB014pApBSM5eGTNjfjQu4oKLWSRq6qkXzdtx0kxe2zg0cbng6tYUGBSX6UgZUp/BaYdlM2RxKrqWGxYu2Qp3oUm4L6TBMjoZMRT4kNiJc4Utk72E4NxnrtNFYvRFzOoAcyA6pUKAopY2GNCH75CpL4kiTJEZZmmtfYnQJmpT83MsRKUxoOEDGgej6YnQ8Yr+IeKN+ilsmsOdg3ewS5GPewJShrUoM6+5EDLJCopbhG/dzHWpZWyyHnHbqTmklTZOCYkhkd9fHYVcuKwbVr/MAgNL7OVoSRoW+uls4N0H8YXEGZKnVWT5HhpaZK15lNsRlWahY60SBtTCLwUizxKfo2LTsmwANipkuK8p8WLmJX57NUaIswftNySFSaKjMsl3QNjkornfkV7p6OdDSca7vXKBfO2jwz7jifaiglbJUKBeMBnYo528PCyHeW9H9nB1w5fTQqB5PjIS+zYVSxMkfnKsp2LE1jICVlMUJNOVarpa1YoFDSZyyjCGklDj2kfJYw0P9C7jU83qj4+Jn4DLP1LsQGUd6XJDXaTFnsSb+0GFFe68cqtDlUWhJv5yH6aXx4cmnG+sW8pNzSWIkUotyVlGb2V5sjuKg8pjO27en0UlsI2y/n2w833k+ZngfvH+AXV/SyL/MiXrnE2hOx//IXANZG1Uh0znMlN+ZUh3Vg86/7j1xNRfQ8+ZpAL+zGk0QUvgiec55lmOrAkdUB9RMVjM9M6FqVdBXZPlk9ahly6PV4MuEQZBYtJ3Q7++/6P3E8i4sKod/Ls+geoqsnzEcvOYfnlihnSKk/WqYUfdJ3026mb5HHq5JMCvX6HBxl5HT1/HhmZXwgj8pCpLVb7SzIsZuZsjWAElBOfv5RRyoJWTko7ycdKrQrjwdVyLF0uXl8461q8AadVotRIR2AByF3hzWKvvVLacUVilFgexlZS/5RbSuxxxlCSzoHRuU/+HH35SlAjT8IdhfFIu4Cy2FUZiWU6tNueB3hgnLXBM3frd2Vc9TKKpIfYPS98z3BODl9GwlMJSvXk8OIZZ7OqTDUgfNyCxYYtVw6FfRvHSnHp8QEeqyB1lWqMME6vmAsqd36zZbeYMMY3+NU7hTUCBx3nPraQx48BeJhDeujGhEL0YVYsEusb7E5q3M0Mfx1yFJ0wOmlu2WZibtv9jCrZBOdJLGeFHCOYqPC2iKbk6tlPQgNspCucsNX0iXRsF4H770mnWiWyeYJMN8A785GlzYWpmdfM7gCWWOQpiTzZ48tBUZF9N5wMBV7kjeV/RQ7MeFdZKr5hVoQKf4rWABG4taXjNDuerAmEhinHrW/rV6RAJffKe/FU+PsLf3QKKKuDFMoDY5xuISAx94bKX7sXuMW+cwdD7oJT+I0dUFZ4Vy41G/Qp09KZIZI3sdZ0mTXzBCnBp3sxS9LO9mXbj0atVH9eTPdTQcbtBAyTOl0+mGMOYCA3MRy/4iD/LlKrXXzGjc/vFO+I+C4x7tr7y8e/0ykp3ncvyniLBMsj6YRJF78GhKtz/M2fZzW1edFNlLdapr2k8q2FG53eiL1xNHDuL+61tL5X5x3vu4H/skRsY9pZfzfeI3R58avC9E0Q5Rek609lNqGdPaKZZGCDk9c5na2dl75eA8FP/jFGmSm51iVqi/Un8+M3xeuf2/fEg3C2Tejq/vJ084rWK+yBMNoiT9WnCZLrkfu8ZIuj3Ec8sUxAgfxAgfxBpZkR0mWLU8LEjiahGMdxKDPxgHoa0KWfZLUKSzSf2xAi1XEhjgjMnvx84xMm6hI/e0N71QmQDvDs34gS1WqV2HJioCV+ymv3bq12yheutxONQeKT3EIFaOjWvduT/b1pkh2uO6G6ao86+phznMvaVFHBf78poZlayoPcQGTiN2kuSrd4WTM08lTtlkIH6zRkar7jrSv4osBiyBWT1v60Q4+5DlPgzBrHNRA98csFzCZ1eLzb3yTAn73rXj5MK72pdytxSWBam+iists1n2qvkcvAK0s0Uy82NltlmPXJlx/5BnnEM8zu6XODHZhQRyY5L7FfBiXcIzSI4U0fDRzXC31y3Cp+xmJqbwY3iAF0uWcyZGCmol3YWHCSKOb0mF0U7dcqmZbJo0HHUt+xwwgYn+dDzNA8dJYIAavDHB/RCmLckMwIhi0BCXDzeocL0ZLWhTNtyrKWPWP8cCh2hit5AmEGuWUIsND8rAfsguq7R1eBS1v95epw8/XThAWH9wDGtiBo8D05HFHS3XWeDGcetzWj7EerlEXFFRre2IG4FbMW2AkNaoo9cN7oPnj5pJ9yZkKZmZXma1fNpbRRZr2xPW0oQplGyG/QXfrJX2n7/YqocV0yqNkB2NmN+5AbfQWPs4uh3O0vZWWi7kidXEr0tLnS1aMMz2kkJzusqNaP0tRrCSOk2FSIkUvZNyiJ3ocs7+fKOYIUdjvBtq1Kgd/cPaXpEjd9gg3Lfvcde+w7Fz/IUzOJsroZtvdssg3P9hROToDLb2hmvnWjU3wgTphRlLlnI/cs3U5nm60m3Wq9bMiemavoAqolJlN/lliZXjpI1cf7UCSEgallMElilDZS9UkCzI14Vt22uTWl0p0RP5sLRNEh3/qFcH9z/xAJ6pclLoUiEjlE0G2SNqWrUlVJ1t2CYdq+5J7mJDrF/Tqf7F2kJFDK0A13aGWhIFiVWlIncPBoVgq1G1GlXPGms9vCGbpW5c9w/gBu6/m1fx31dcXLT6qyUx0uy36B3a8MzpwoMr1++z2a+aVCMjWlUuL2/IMmvaTPcp3Edvfoi7V5GobB46ooWiqXevfNmDOF2ZjGYdmzJdNIYcL9SPNYzMd8m+oE67/9+PDDcA+oJnaP980OjHqf13tOgB+Lcu1nf9P/9/2m8exGkcvG8ACtgfdcgGwMGVcz4z+02Q4c1+NUoFK+q/rf9qn9LZFSjzraSZibjuiZg/hVSIsL6goC+TGmRCs5htVRNuFZItqHJYw/YejwOG4QNfqKAZ+bABqcDrOrg+KKxzTk0u5jNY45RVONZZ7XIilzqh+dvQUpG09AzN0oEQzsOKk7qmDLWM2RlJZSE4YmttfwCkrWyJi23xxI2ebw3OefZzjcKSV7p4Ce38dBaCxtzCOb/EtUVVD3MnWxTzuBv90QrRj6MxPUXPDKVTnvfM4zd1+PQ67ZnBf4YrrY/K6ijzk0NZfdS6w1FnpNJZyUunpZRfT0PBn9c2zPPhKOOQ2AZ3Znx3amzgGeZ072n69dl4Erdi5dldja9f6vQXMft5rSkRUwln/VbNfMlzuAvZLHiNGjVjUegkyoJ/s+RPa1h5/5U7TQX0e4b+vOl2rrRJ0TyOGDWPmvotHpWpowfnZ0HousdlU2G/aYgZG4xtnhexPTWfsoFlgU6AlUP0RxuQo4795YMJuRCbxjwWyIYsYrB/SP9cQrV5Xopti2wJWZBF4+tX1vqrH5DtjvOTJhM5Ya9iNim8siELQGy2qltc5/VLy94lfDcWUE3kx4qhHpMy1qRNbqDeDsC6nu5NT2Vd+HNOoxoc7z3hfZd2L+72CSXLU21VQRWKdiiCvzE9Rg+tfk91ZvJbkLBZbRDg4Mq8CwDzMUQnlfa294IsPA9S2dOlyosrTXYs4qzgpCHAv5hAMoCo2uQk6eovgVP96axV+drL8t9MKyjt0xqT6WkDyhVl9jmctuCKs2PDUdePpup09QerzSOA+wA0DcKmchoMh75pcGwuKog+u9OQpLyYhiJUEpeVg3PZMxKDJAVZhDDh4uEpkqfwnoRnJoZyIwhCZrVAFETWbZAoBJ+jhozbeW4h4oQgSxQimCxQzzVcxPPnk26wIAbJ+pVL8964P8W+KwB3ECPQK/ESeCEYjAGhnlSYBAQByMATPuS/cn2OyLvEqTJOBCTx9hTZDiVqtG62Vg14PAiboqyCkpqWuT2ohdajjBk8dK9MfGAH1axMokmOnKRRi6wAJHPBg4QLISsGWRg5BBGChCBajOKM5VizYMSELScmZOJYKw/4bAAX7WkBpICg8BDn65rT83Cc3L+f2ySjKCtfE9mhBmXBhif3L6C6Rk3wBxC4h6ExY8GKDTsOnDC4YOFwO4YHLz78BAgSIkyEKDwx4iQcJ0nKgfDKZ0iTIUvOkj5FZ8JuNSM1Gh7txlXXZ8CQEWMmTJkxZ8GSFWs2bNmxdzb8J4IzF67cuPPgyYs3H778+AsopB75ClxU76VC5ajaDOktlBJ35KkppjpQpgHFsgfFrN2wr774ptuYDevOChSkUrArQly2adtV12w5EuqGHdeNC/NBlQN79oV77a1ikSJEiUZA1ClGLBKyOAniJUrySrJUKdJkSDenS5ZM2XK88Q7DTTTnisUt990u1jpeJ0yYNGPWiinTVhVx/wjEAXGCS2AeXIAwEBcoBe8hLISDuKFjEA/EC/FB/JAAJAgJQcKQCCQK4SExSBySgI5DkpAUdAI6CZ1iSiBGyL8WR4URUkjhitum8WKIgbzWCRsqoo+SU2OkoqER/D3o1UcjZIjyJ8BEOdXnJ6rUlBHeW2IrbmpiakqUwsZsrxOydRNG0KF+EcuIiLAAJ4GwuA4Ji6uRRMcnxcg6OYyjY4ghKsGcGkLelyyu/HkDdfxrq1BEYjuBjotI5jCPBviaPaAA7+yYGCGGuhJ5GFhxAABrc/AeB8CB9mnS2M7QwBkwAWFgZ6AJLiich1kuTXlJQQxAnwGzkLmWrBi3TJuFuZurn6T7gjsaKUvyCOFro32GX0hVaXF+TqFifUwVBcVUleStKSF0Zpi9hoCYnU1UpbjFkuhvpSp8WfOCbTliuz1REqQtdm4MGzNKHNqKJ4S4xKmvfEqYe2PsDQz6wASWlekMDbhWeyf0BKC4Cb8pWZGr+Ak7YqhgnP8RrYQJPfzImpwi0LkO3ke04if8qGCb/9FrGDE4cngobl14KA4=') format('woff2');
          unicode-range: U+0000-00FF, U+0131, U+0152-0153, U+02BB-02BC, U+02C6, U+02DA, U+02DC, U+2000-206F, U+2074, U+20AC, U+2122, U+2191, U+2193, U+2212, U+2215, U+FEFF, U+FFFD;
      }

      @font-face {
        font-family: 'Roboto';
        font-weight: bold;
        font-style: normal;
        font-display: auto;
        src: local('Roboto Bold'), local('Roboto-Bold'),
          url('data:application/font-woff2;charset=utf-8;base64,d09GMgABAAAAAD50ABEAAAAAjZwAAD4SAAEAAAAAAAAAAAAAAAAAAAAAAAAAAAAAGjobmk4cg0oGYACCBAhICYM8EQwKgdhcgcALC4NyAAE2AiQDh1QEIAWEageGfAyCKRstfgfYNo0G2u1AhCddVj4KgY2DDcR7zMhALRV0/2X//58S6Bg7aDtYmMgIJLaKxkKneetD84Vb4Ra6Luoeq1pO+Jy0PLHURYbIWPkSu0CNxcLM6hFZ85jRaSM0ZHWTX+T3P6rQmnRU6V1/deMv537KIQ5pseeGIZiDN/2wZlKz7SU7od0ivr8gMCpDd3DyO/WQOTvhLtWm3vbuOwPbRv4kJy8Pkd1Tr6qrZ3b3REQiosusFFIohWZ0lxF/hufn1vvbiB4MAckNtBGBMWJUbCNqDMYY2SNKEJEYmYKSOdoipUSPFoxEoQ3Mu7MO5/J+hMJWTT0B2wJeIUmBrNz/6urfK7LQkizjmGc8u/xHD2g3xFV+FcCiyTnIRbc/9cc+2HOPLgMTKDruEPqvZXv9/8xelvhLAbIwYykk2SUjsCu3kApFrVLUyFPgghs/3asOYIGRLuOsYCs82P6Z6y5rtoVlY6PKDL3Pfjjo1NwmzULFKpkjQoj2MkmkJY5IDoTk8u8TcPpnTHYM1sacYijZUJMl/+c/XevPRgZfapQG8BOYWPU70mnNSJadzO5a9j93gFR+9d3uynSRKXESH7BhGinXSU7RPEELWFRIkuGAH/4//ZnSlwH42wsM1RZNgIo2qdMW953ReAno7zXeCUaT8VLFIhCDUl9awYxnQsm1Sh3kTP8c0OHh4YF0kAPV+/s1K7VV//dPDy79XVZELsIdoENhrs6dUL9f/2y6/++eZLonU+memapMspTJcGYxs0Q5ZkeggJIs5gjRAqozYtWxEO5q1dYpFNKdMOf/v6pZ+y4pUpGH879z56r8pGacK7troEdwHgWQ1AwgTQqkU5THIe3qf4h7iA/pnAEcQiqacZcqb+ey29Bt06/Zfn5siEEcmTfWEhGvtN+zXKkecCu4FUSQtcarE0LrltL+kPRluNK9/9vOa0CxoAHKyY59F68nfJ3dMi1H1X4Bhl/7o64OBg6yCfLWNpgdP0AgMMD8gIVBgACJBwHmUaQDsdMu2yuIn/ji2SB+6rNqgfhZh4CAOATAY8u5M0/2CHAC1hyCMZW46+J+Je29dguFYhQjVMKkNba+Nt/Gwzz5c/E2n+J5IvFpniGZ1JayKCuKO59tyCZSyOqkSDNq9iXZIt3TrNaIZF8bL59PLBV3PawDkhgJ2WL84yBECOx48EI56bQzzjrnIkVYKnBUqcPTpE2HLhJT5qzYsEVmj4rGiTNXKVKlYUqXIUu2HLnyFCtVplyFa8yAWh06dek2YNCQYTfdMm7SjEVLVqza8BhEvSkIeMI0naJNRC0REFScFCH3gZB92cn0KKRInTDjXiJ0gGiQmCGjRNu3zbF9tHY5m1RKelKlYUqXkWropUZNmrVoTbV3oEOnLt0GDRl2063U3faNGDWWGm/XZJim9fI+WIP1DcSpidZrH4Kh4pc5jo16r+B7R7ND2r1Qi4BQLIT3B0tvu4QToin2jXFqWUhBEguRmaG2Ot2pDgIfYfoEEzab3KFAAK+DPn/FJ7ewU+gDjcZ1N1SrKRbFDomnxbMthNAuIpCYodR5Q/sQOkinLt2mUzOQFi1ZsWrD42jIUhV4EDpENEjMULTr0KlLt+nnEUwJo1LmRJBxmwO5TYMwZNhNt6KWiGGDLJWQsWzNej1Zhw4dOnRYxe+Ak6sHtY+cegWOr236fdXpIxjTPnBqHySzV/hxt4mPMP4W6RNi2j77HqO2zx1KSN0S+0dmtdqacKdxj1pNuj8+iGUoiDLFB4VQBSIhMVuTY6CEkw6JccKjfQkdpFOX7tRgDEOG3XQrTGt9iPx32NmBAM4/VydJDDDxj0xve6dSb8sO+quOHq2T++11me4aZU9Lfe0bShf6WEYBw2sQMhpPHu/nHx+th5/Qb63yZswiJxbLtt7P3T62Lq9twJcp/5Fz9D9S830LAmGP7pHK/8XJ/3lvmGnNLPLV3EtHODPrntzQ7d6k2moPR/cxidKB9Fhve9zduycFNNFhtQQJNdNmn6h++T2CHSeUX7VALb0rTcXkchlR6wY8kA00JQS21U9gU9mnzpxzPl9XwJUmt5X/Hl8K65qq3KHKA+yzN2fnziv46L/lPkaHEq752pTPm2e+SaipPCcW+Vowv+Dwln3jj/in5zULGhRx3a/WQdjj1yC68RpKazfs9lC/10ANsZT7Yjrd6ppGZbQwuMYD9YyLDfOs3veoV8h/a6owPLUGA9fpUd332LtLuSZLeqV3DZZH51u4ebZEnuvYzLMznT6I4RN2UGA+CkFSGKHycCedhSBPBRd1OseexgiOI4FKMg+WYsOONHsqi/ZsyqFzcUKKDKdlueaC62ppa9DKQLtuRANusXiF5JHN4NbtLVrjYN1jzmDU4yGiRJRIYAkGCnOKHneaCjpDIWcpGwXK7SLloUhFYClEhQpTp3w0KDc8FadJxWhRJG3KS4cKMKbsTCgHgjiWbi1OjEjbQiCDwtlRDvYUhUa50KkQZ8rFRfLLgGEMwYKy5WFTXA5S6hrIdTW41RrJKw9mZwg+pkM3TgPBCINugRunXCYoh0nKZYYFumiJLluG15qeqDWiEtalxCvPiKicRJAIesIEiYoQosJOSnZ4MOdBYRSoKCyFwVEYNcEvYS1uwkWOERQRIDwECeKlSSBmJCHZCJwgPDgKKMSB8nIUbBIeECfh9PgwIEWEJOwSJl42TJUqME24CA/mYCAQgTNMumsMm+SEx2mqojDTFDKTLegfC0TkJIJEmAgSYSJsC76TOmwJHlaeU1o5bCQhtj9ixsHvOL52Q3cZj1rPHTTeLDqFVBMM20DtNqJFyoTj3hS1FEId+DvFE2XInoW6CPX51vtnUdmG6S90POwD0+oyQAN/N9QEJFcEaAJunx0HpBOIwjGxrLzXk5z+FUVBIA8gXKkHDPuq/LbAmbLwFozF/j1Kkm1q7Z20ZtrUlJ3MjURhN+E0SQjEJw10sAo/ywDf+0S0Afc908Jtz64d+w4ceu+DjzrcxOLP9ZEEUaJ99sVX33z3AwxEmBSg1YZ5FxvQb+1YIFZazm7v8XmzO8u8RhcDawH2BKwMsOu+hwWggen/CvwBThkrE6BBdwHUtp0FWBn8cF3LxdMCUIRP3tbQDou9WgtI9DdKQc67OZNP8/nKiZ6Lng+9+NzO47ybT+eH8+38dj6XH1+nu/C/v3//L38Jomi1e2U7abG5mftDfjDf/GwS0x/lXblXiqbwffzh9/d/3/9l7vXk64nXt/NwHsr9mZWbcm0uz36Ps2/ufv0DvfEOxOyC1rWn0R+W3EJJp2lrElwALD5zI5xV0A2Dp7YlXLmQnUV4EHMsmgkO4/iHb8AAnia/J3rWh/0D3Xh4xt8rTrZ8Ke15uHXgkDk8evDkYIdgax38kBP4IhlLVTmO4+U5jhN+OJwRFlo7LXKJjzWGruWxXPRGLJLSpvdFte4QjkECu8koxk8HkyeNp/t3ioedJ+/LoYwEtSckr2QtB7RHQTslq+pQxacNzR+PhUhRJ1pt2eoGGxMxEs/WY3y3ElWLWuZRnOlgL9ozzVBjTykBXwTn1s97jboVpFlgLqpUF/AOvcPORIJfVVmd3z/ENFg0wLMXbXiYrnLNHK/lnkzpNeuqAXLXFL5nSphNBOO/j7xxIcHE6BDpZHE2NElnxohUNDOmoj/idHRlpdd4yr/gPvBg/xh9gg6sDN8Da0AXKYqQNj7yKMrFxrbEJpyfUVccxsitDDTsaIHJXNahmikQ8hEHpx/zaF6M3rFiZJ1hZbucuOUvi9bhPLSL9wXcciF7BiVUdgXiCo3i28jOjpwh2yyroHSrf3tSzVhPDza1hg5SsxCcUdTQ1PL2QtO5TnltdJVySvlGPTGCOCEGo4zaGpqliVOZNbK0Tp6LjKdGKkHFzUc4aW8GpypR9jqjOlUpHYM1XjltT8v22y1TG9pUVO7m3teUHozSnXW9SpytJNXK0OaE5lpZntqN9MRb00hpxeWlFoOhxpRCeEUbMxohjdI1y+w7hNMlFZRuKKUVrc/oecOtPtG0LxTPlShVZr/qj3l7d23Y8nftBDgsD2iqximFKKOExZxr5InOLHqCslSTUDWHiZqoBYrSxiZJHDNjYHrZAAXkOciYUUIgygFcrRoIIccMtUuIlPMd1rkUWLAjMowbEDvnnWyuEanG8w9aNs2XDCaA9qKR1vWFKfaAkTax16uX4q172GVNIxj8xWnpwr9UYazPBSYTDuytjJ6rs3YUiaW2C93EM8oGuVwZ7gadhqj1TLuuGzXLypEVcpEy6lFQKEdn5EQZ/YAxF627IRa8J4pc1XDP6H1Z7zJ0taPg7QRVud7GI+LGCg4WXDUkQ2Pjuu9LnnSb8gSo5lym5HV39zF2FAsgR7ply2qsvEfCsArlWiqWwEXn3KqcErqGzgMMlBHdtvWfi7G+FrQS8gREfZbjseQy3sjMjBmvrFk5Foh3rNv4xzjKGTco5L/QysDe9bbGN65FvvFp7FB0eMiZIjtcwWqhWWJ02J3A2B2ka38CNBOR0hvaR+/on+oL3RLGmaBOWFm8YKHjKfhmK4OwyLmfTB5LvfyqVSHzO6HZ62zznL6G5udqvNtpfmfoQuWaZDWRp9WGGDba12RS7zpK4ibUFfrpQ5x95AwQFlJfI+cmC4D2tu7pcwUQLXNnWlyD/kty2fGhwlUY2BIryBuRWck9a6kceP+ZwCjx0pFexx6q4HtKDczJojnClvVH2tnVOxiokxPZI+8rnijQww3HND1wkWQ5Lap0oZLiSLBiHFuBrwUga1iQ7KfKurJ75TEr0y+tNrr7/RhnRNccqjk7IKdOBAHdfNXOTb3KU53xTngxfb4Hck2uS7yRi9FHJj9bUkWim4lLJ1iN5VRxA/c7mLDggdrekVt9Odw9RcN4QXrc1vPhBnTFLGCaCIBITuxooNwT4hoNxQ5NKlhl2lL+ZzUHAVfNJyJqvpNDOEw5jyMl4LaIxqWDNLQQCNKR2QGOXeoXo9Cossgw/28MGQ5DPIy1T0FPTZKKq3qmNN2IMUxEKDUlH8r5pls1GZkmRCucM1EiFMETh/o77mNIABXpNAdqLUxdG9xIjKJIh2gu4YW7Hxakxx/Yuk3JdbVFJxQaYg1vVkD4g5uashExcuA6uNjU35HOJQxrfcgsSvaBn1RBrvNWZMJrMtTbEl9jos/s536bcDpyOAIOO3tlQvJcQEykqxvob/1IUX+INk6wa69CsUo2sEzihBeSO474n54xnUs2IaNZ5BEK90jreOupQmTgfvaaPBH6kYYEbbQIEw+EYtSsadSgTT4BTubZlD8d+NMtVnAosQrHrtoYOyjF7uKYzOdL6dyA3GwSCxPaSTw30SpsvxnIBSSgZZvFgwsXrPC6VtpCMZEMOWifuw/Pa0K5BC97KyNAcmQi4NaGeNNFLaGwekgaBcxtXNsA0Rh3utUYhM5rDO40YgeGgGuW5YZqW4AEBUWpPCqUKHZVvaSKJekp/jsQkXNnL+wZUFzFciAMOLkS+MYVJw/HsDT4AEpyaTY2rsa4ZcbQbpsQVtwu9mJ1lZLHck9e2X+fm+JJCJdaRm+VAhOLlYCbD04Eu/4beBgpIxAxuWWshsM2ZZqZww6VVIFf6hca0duB3vNIy0rVxxKX0Z9D6DeysymakCTB0CjkuCJZZEZlHPyXd8ZdgOKo4pKdGKesYqNDp4stxDm6L4GIVZ+4sOb+12CzYKj3vX9vANRXkxAyfYjbu2OsY1PRlghG5GnsCZ9nv5LhhUQLxuhEZDBI4UFcY3Ec/LWqG/hWhisNWcsyJeoKZN2fqg0RGBt5pckLyckU1KaSzcFWsDkw/U291S8T4FiIhP0KT0hkrHEEh5ZMHYrRtiiz2RF5jmwjR/ImMSZzrZLrQDEfjtfYS4Fb6SVBV2IMmCRodWjsdGNm7QuYSsBIya9Zb71ufDdnvEzHjFdhwbFATyhyHgssN/N8o9YM5EqRb8Abj9ddGxf+8fTFVWOvkMLJJILDiqCtE6PWpxgTxrK9KkCSbeJKVhwtV096ZofPueMUl+o5YLEGhcAf8mW4GVbsmoGsJhwIFtQPoqtnNd2SS9T5u/l3fqlYf5l/63UuG0RhB5dtLc3uyPrvAXRWYWRI1jb+lRzWaWuqrW5Cn5qNwLJhmaOSzuxnS1MPQrH4K2/MD48oUCBBcY0aDnmi3hQF2iKHXELFuXbhyXg6iSeduWtCi4/vjK7FdUbAEIiWAJo2vOiRReOcXQtfq+GliGw/88FE5sn8auT1lCVZZLmuunECm/Lj0fGj3PLDUJ7Qjm3xzLR3QnO0YzxIAg/yhAACQmkHoi/wtmZTgdS/2dO3IqeAb31uYkgyfR+eLFNL2hC5xjWMt2ko0R8xgOQMGBGtxRI36j/EPTf+MLaStrBt+xGmfGHTFqo+tdED3/O+WLibLfBK1T0fQoyjP/LEvK2DQ84ZkDPcumT0E0zuSIWrMZ9EpRgaNFUkYrlUqr0Wsin6dGX9yXmjzFPeuC/zr00Qrg1LobedkJLEbjcHsWbIoEk0HH/W/f/ee935JxanGU/IbvVktZL7FVua2xObG9YMP51cj7aNjT7B9donLLHZr/cwsR7RZFtHuq25g9MH12t2/gFqGU7tq6u3hGZrZh4ee/39H0wMIzGA6k0PZ/tawexqzs3vaswlpnc15OZ1N+aMsWkZERn6JB1TLX0SXs2QqC+TcjG9pzEnr7s+n8jsaMwv6GrKHIOrESxUL6WbaxkSGYZEXehrjpl8ZHiOWbpJujejo8xPz55UQW5fXxtqWJoo7O5JDbX+Xw4fkfNdMrnnyS+iKaXWf/kxfHMP4UfXkDazpJr5OoQEQagoM4cwc+UmeYIXiYTXMbWKFMQFSxYPn14TjbfairvxXidLW62qMLDhnoLMxbrp4lC1inStfZX4YvgzpJv65tW6L7pZmmoVuQENIzAM7nz9bGFY+BMa/wmXWgV7jjxGntSg4gdUE1D0KZSnwiX8kC51mauaMSjXf7w6EH3e86I/m38FqiKALSAdJXErqMxSTs8gDop9/RXMgpDgNzK1/2P3sEKXc43pFBMCnWJs5GRHJDjZyd1P2MAwL2ygDMNpCv/pHn34qQE7wav0S/P5T3XYCfTxQY9Gfx+367Bmjz63zsAA5yaonYjB0KgBB7QNGTxpe2b9m5s//QbB3T3EyYPBDJFNS3y2k1D85t+N6aDQV+klpvRwJ7FiamWIf7AT1c+dTg6lkTDhlwaee6ftsD2f9Ipr8ZC/dD62J3ZSfG/vqfDWCMb2ki/NNzKI9vTTtULN+hNNe02aGE0K7+DJL2MnTmFzDGBo09wH5LeKR4Zy6j6qkUsH0G5u9MsXl8pT3wQkT8DjpTlpQV5UD/+cqwlxKQzfb7eC1XBjHyTvwT5Mi/ZERPWOvhJ4mXdp6/WVvG1xXR6/930BljPPwd5jkzBiB7UwrN7XObwoKiai0MXoGL8cjl9JzmhmbR+B1U+9EODfQFf0V47vi5vkeD3D9WYiLr7fT4mu6NcQcPvH80dr/z5FYo1dg8Oc6cEMN+fAMDeXgGCpZxRHH1sbR0+qg6N/I9U/STHchBFSPrHD+SY/4cOr1JyCV/nxfKArMMi/xozPBBx9SpB1oyZehKKY4tA6F4fQ6tiYoAo3dnaqv8acGG45+LAJFhPR89hPPEy8UeD03SCjeRHVsOAD8wqEiIrQRnMMmwZqNb3U266bUmmQlSw0+nljZW3v4R2KWZmLk7W5GZHbXUtS2ZBmn0ezD2ijiP8AuQXbinH//R3es08gyRh5ZtcV1XxD3RdsTAazmZH5Xvr7yvpclqpkLXr8OlsXko6Pxk1cuNflx70r4K6ZrEkePKEvffLa7IKiP2fE2lA1jwwP6u1gxocfP3G9P1/3agR3imGGuZIDRdL67OOgsxGJ9xI1r8rze57XxWyxRGSPsXQx0kFDaEIyYGP94RKcnwoMrnc/GSqR1Ba/wrPxA+KKy4QCor0c5xZgQqsvN+G9nuH2CStlVoVbyH11PiCmF0tyXCnWFWof+oXlE/0iz53DTMwqK1mH3oQc5j2pzM5I5Eol/JSPjyt0tuk8MHzQrHmxaxRwRY48LGTd2oIeWbwcfterqbMZo8dsPFoCbKyFL/VOetRdK1mPLC+JgS8ZsdMraI2+ae12OmBgRLKxUgNa9XxapCPcehsu91384AQqISMi9lrNFth03uraa20jEH4KvtCOsFUEjzBIjPHZ8pYkS3mLicdHKyX/iCX/KfvS2quI3B1of0Mh0NHb3d47KliRRKhqqW2/ByUpA+EvwxBMjOFZb/OuT5eP2rY8orPoJpaoF1rUCJ0F2FgX8qS6xUq0F8RStaS68obkOtqiwSMnUkZHx7+SJ4rHx8+b224Ob5QbivcMD0p0VRmAZeJGpYl4d5B4d6XJ+kXwf8P7ivKGfbBJeNXwrbK87hBsErsANHbnjXrjvzFpz3PXT3yHs3/mjUkI9Qu8nBICoaxsJ4cfpshH0o5GRltx/xI1iCavC388dv07JgUT3VopTZpJxuNt+Q3QcM7PYfHh3r6RUXFHnmo2iZQYmpoXTfFH2tvo1Jv/+lZd/8Jg/pMi73U5JDwkjm5OyHPNOvvXfO9t+4jU+udW1KWCR7kXjtCBMfY+5o0joyPyIze/1F+0YGONfTx3DP63rmAH8/IT+RnJcb/hXPe1q/yEGwmWMoMsDZlSloW6FdTIa8R7XhjHUuBfXahNhfkunue14xZAcP9xO9N/G/nNsWW574Wz6O/CcB7YUsaRfDoFrZBPlHpbi1RCls8mSWns08sjCusCgm/xi1GniWzaWB5gx+a9YgGOI9YJ4LFOn2K/cAYF5tVr9a/yI4XyT0si6rvmts+tr9Tdtk5rgKv5/NeQuJzd/HsUTlNkUzXTL7K1Zmk4p/PP8CeQpmNm7kgm2RprY1wialZpqXP7c0OPwLWzloJCc3qB6jW3g57wlQJVM+M4w00U4oXsLMuPyRuOAOwAc9ozsmHmtSwnGtHoW+abhWV0qIRl55zPFNb3UVyz9nSAiAIgOGrooVfCLs8pBOp/rrO7D75uQ2MCENnTz9bbp6hJusW70EL/xO/N89PVPlFnZEERsPGFBzLbx7bl0d8r/Ou8maqMDhwjbdnTDfXhnNwXyYbLYDur5OUfUSi6l88/50pQi3NsbrWe0wsf7pRY+4AI/sAiUcjV0y961KdurY4+tDR3V8seBXulrtJwzWFjbcPH2+jEf4cX7/d5xPF4s4vkJS3vBd+IeeOiYXqlJzC2MuLKpTC8J6Ph3ifFX2jO4qhm31R1j1kNj6t+0W0pYsVT4ZndboiKQUyXsxXV+Yq6O4QBRYAxrZXFyyqL6tuTzUwdyPoGVHIRlawrLoyP6h+Z6TczRG6pn07JjhFpbSyzv8oy+9Hr62s6+O99shpB2MiJOdkabW5cKwuKQFZK9B2eMzY8Z2rZojGscZXV8XChX7aPTrBzSlaKB9uYXhcS2TFe1fs3Bh8rWoLnTIgouNfZch+au4MZoFvZOl/S8v2Jwdvpn6qL/7mbWflMmEdgCyL9d0x+TeQ8DM1RGVEf5B9V21se1RQYENFobLiC+n9TfqLRK+wPBnhPebn8/S63zb04jUCzlQc0+GQo+95RCchYZOif+ru5mun2SRVi/AFsT2V/ezLqJ7bOo/+rCqrzTFP1H8N5p3oF1wXLfznfcqFROWQKgxfkSLIvqVS8Trh5DuenFSF61fpHwYfxiYXvE1UYHStrCslKH6tIw2+cI4m/Iy+W/B66n7HiFtPqIQQ397dxJNvpOEuWGnHfWrslqbWqr2jyzO44TZFNmVC9Vs1t9z044OpI99AsND6NudNWWazq/UcWj7SDu809VhBZwwuLrOEV1PUnMnNZooJG+M8PWx+2Hgka4UVzeqZ7lt24vw8a4LCCeqdVx8ljZDW908qCqmRYxWytqoTKZqzb6itdPaFnLFtrJX8MVXRAW83o9q7gXjLrV82Hfc8OE5Kvr1fQ7GrfYjd8Zu1W/9t+ZbVaMwmLLOjSymYfrc/p7Rpirwx7wYmvB7CP9qAw0+U4+MHa5pDDkMPOMny3XF2ttk+pfxMMb8Bnuhf7lp9wOLt6XDAnH799a6fYNFG9qdoET/C0XIduD7wps7yiWV9pqGnqb45tSzyCoT5hUYMnDZ0oOU4UZpFtULaJto8eEioYX6mU3J/buy21KrMp8nQZc1fm9dybesmbL6B6JETx9LHx8S4BNZhWnwI7rC5bVrw2MfdI7ohOEKxDVNUfVrJvzn/fW1w7ej0uQ7F3tDGwd3fj3MQdRhoiA6sT5x/cuJyUkpPPzPCsmn4YVJtftBTILagMn5isjMwvlgLFZQHV8xPuVVk5KKAeHh8dOD8aGRrSsGGx6JjAuZGIUAYYdm2asp4Jr7Aa+vef9qAj0N1oEXkR5W7lCOWerwb3NcOu8EkgJOYQ3xFipIk3Q3VUpvftHqGZz5D0owdoUL/icoURYaqrn2QT5HUzmFYaMFBHT/e51SG2/PGHwJv7GIdLAYEhMRZGpBBSmPtksHPFcrjpWU9jW9P40y8MbBScdWiWUaeZojgKzoKorWNG8jMzTTA3XcaqWhPxmpYknMryfxWkjVfsKrrr9O6uDYR1j65VN3Q2ll53c7Kl0r2YgBEf5c2kOzpaezSlNpdKCrY31CAbqmTsKmWQzXpCbeUyNsiW+duOpjNJpjO3HecfjtCI02MTxNk7jqVO45V+5jYJ0cmX/ENaYrt8sFci9YnKip18ft1JGelV+Wla7setXa+eIZ9ozQgwAxRNJSpDSzB6DhHfYShBeUzxrG2QD3j438VTmk257fHyroxEBkN7QTGkkd2wDFk1UWuub2BxIy3D1EVXxcQETwe5Rbgmjr6WvuMc71jhdXUhwdW129XXg4Margtw4oxMcCpGZgEEMz8iQekcuZt4RAz6HWR1ZOXwW2ga4Xbgpj9QGZQlDY4qkkXtXJW7Li5Ett9IL6lNijEhRATaF4e7OgkKh9nGUOUylc51S/3j03oppbA9OjCGqVR6Jt9/KLEkryM1fEHWUFFFy0iOHgfoxULNQFMYd5ApPoUPTbSO9ixV8/uJwfOxGVKpGT4E+ZsY4D21yeK03ub8vf6I68/2OeCxzmffNHai5NEpWc52JkSa/XEqe1upeFHI0JVm9maGzTkDaVOEdJ6iQOXDE3fPVEfFovQ5vNxrRydVxyaaiTV3Jm9Uj9xr6EZ40IOtLWmBwM3anR5sZUkP8sEhryWnaTdUF6sTJEnyNyotaI6QNQYaO1pfeXQwf7emosKNLnnKHaLKKcVi3B7FVT163sgCcJXPfLTZnKx0kvXvoT2/x/fDQ4HMAAvIUU1UIx51dbVqkweGB2LqxxKGV58VFvbd2n9qdNVWkvrMi6tfQi9SWb3q1tZyUVVRteP/FlTEXcSpk23rsM02JhvbFdzNO5qa9NOYM93boZ4sG1L8nbTNvmkyPkmzU5Ex+pWoFVg9fTJjEeUn/YZ3jBWcy+sPwSYFxYVCiXuzeLbrwIeQKw+Z88JfPiI+y2CAx0J/GXgVdTVqKjEmFHJsxVg8//F+c2x7piMooMvipJalg0VZWknv1tSGzQ2ZGNw7d2ycFZmoq2Bkb6NfGlPmFjxgZUK1NapBrNG4tPLut3gt/COrSNfoocXl249662786PgMWjXMrSkWti4mKmihUsTdpdWI4Muhs9DaEfvujevcEVlxURbJMvby5neJauu6Kow1pQh5j5FGFxBC1la3NlBSbqQFhfMGJUq62Hu/5ALqHYI7dvwPG0g37UwVfF9WXLCVmPQ6Y+cb90JGoJlieSRjNM4irNwtglB8ivbq/cXelPYg87COp4a2xWHhJVcZMXkevnED1TQubr93RsqaiG1Eg4wRjUwk0G2NDR1tTc0cyPvLdc6l9jXztpM0zqvzWZktMfnvmPy+q/VxQnGdz+pCIVoj+YwFHKV9PiCicbQ8/ITNXyHP+EfV+qFQKC7DzwV4cU/Gb1lQqpWVG3vXz7w6yYFmf9j9SsV5j+H8mIs+LRg8RipKD0Q3o+K6UUUV3LBW7a4ypHApK74ZFfmlzkn3QJfZQHKTcvHlPQzlo5Y13ASdOFbznTLbU3Vx/+9kVe5kl6SVrUPr36DD6jwBRnKCLyUNbSNveZuo8UQvZi+7JLNkRfgcHM1RxagPCgir7bsW0RDgH9aAZzVauIcJBISKu9PdC9Uid3m3rxVcK9hEnka1anBEXbC/Gu1MT46kUq5EuLpfjgq3la/2qpZX6PboPqfq/TUspcL1VK2v2nMJOUihhSs0ucpV2jJG49lxObSCgeC2bLolJR2W3bJV5uK3huGVO9oWZMLy27araJ7LmPuKvEOLy7DiwQ+gCVA9/kEtGeW5MWmw6sfdZ4Cb89O/RBpPKYYVbjyL85Cr1xMZ5m+/lMt+QUnxkNd53+SEAP/U+EBRC56PebdF01CiabeRyP6qP8adfcfHfGR70ImadzoXSm0TYYUoKiqu8reTljuKl0zlUBbn+NlW0ZbQVtGB/Kklwu6fLC332VnGSUIcbVFhlWBVrJv6OcSVGOLmniRdHRl6ObRUOumw92pPXk9GUHmIrqyd66GrkD7TVvPL4sfLcG9R79NR+4ka6ZQT0zSpuay0oCYLSnwgVHxe44qKK12TpqfgZH6fNt8+b9qPQCDAuWrvUAfns8+MMvTg+/M36eP4sx/cJQOROvP98o/WHvmky+Jl01SM0RQu06kW0ixXyPb8Fu2gOzvza+W2MsD7JutSD1texGqZkxVB2tPr7+VjvQRk8bITQ3JswOj+/GqBI9U+wENTuMyY6qNOSfVgOahDpuCdZaq9uMra5uLSmiaoqKuqoa2wqKHj2gPOsgBPOHPaTlVP2RuWSUQ+yh67MzW+xtQWas0/NTQepteHhZCF+rVHpvYJuPIf9dbCzH3j1MyUS/FtFdlX+1MhrwW4sbdfGLZTW/nc/XC5hpOtRUkUfkcjvcDo1Ly4yM7rGdc66mEl2ktf9nerblkpnoqPvKCvreTp11tnWvfYLKS1+Qq2Rjc8RC1JMymoPrawoDk26GoynqHB8LsRw10ddeuOTYCvzZkcxYs5QoEkBwrJwoFS8FzBAGsdn52cEtvbnFLQ2AwqNB8/f7wn2BDgLIXTI1/XZbOI8pfHG6sFRqJQuSmf+03uT0FoAouMdV36b6ssfObQhx6LJAC5JOjRJ98RGpcOD2DRAQhya5724k8jD1h4LdidXlqFLf0sZHAuMoKD7AbsKt/0fd4/Vp3avNOQvtoYn3DQzIES+xSyatElnBRBl1EIxJbWQWNi6qCzRibfNxMqaOHTB3rsnzAXrlFKTk+Ij6npLznbZWQ9NHDQmMgeOSuV88kaWBdCjj8xcdAY+BGzkwpH7WRlK8dIdm1sakRKxZIVFUseqFiypmLJtqXBUOs/VYN0qxqkxdbQZDKinSjANtY0GVCNI2rW+QYwu3FzxP1tJrTwsMA9gQs8xgrXQUAg+piEBvc8AO9TRYB7B82uA0zKTvY9aVsiO7KMAXVr96Fvy3o5pLZl2cal7G+TUyFVKplYB8jK7gGyckCArJxkO4aSctWRmAcc7Z23QFeOs50JRMxy9qL1vQEsIWcX8+oHYP5WWo+9VD6nMDiLc6JPLoYrq2ZpweFL4V8lNE5YC4TiNRrdxrq3SZ45Yod7VSuQtwW8h29WD9RD9b36Qf2ofOoENGaJvLi9evlnscbfzfoKezWBi4ALpm9MFZ3GrBj76YeKhcuttl0XEj+tLt+hSGi9rYo30M/p7eyA/mZncQGG+fvzOIB+1KhaU7Eq93cnn/2sRH/GKclAHTBq1HryTc8B8eoWlUbzLlRPPfgx3OU/MvJRPjN91RHLfjqMCqMqVOxQbpH1YQlrhhabAAPqR2x0NtgHGNRn9ocodjiDWYl8D5aI5mxIDwAF+9rUCsQj/UhMU5U3VJcb+BZcVfymPs0fqIX6TAapZ8NwAACtg67xOwwCAw0T4LOrgnRo2wn4dkTc4jenXTU1PcGo7iuLM0qssQ2rItpq23y6rpi+xag4S7c9CdQAwHbtWVoNAGyRVTneWQiZm339JuEK2sXY7CVskr7XR2A11BempA0zJ7tp82vRP4R3iHAcG24evvJawFAFpj8UU9a6hj0EOBHtUkfMSiAthb3s8eg+1CU3iDaglTAmFQQrrIoZTf79qy+L347/dZpcBXHcIOVjkUUiWOl0X/euKL6KbNpI0NO8oGlkqcM0DXzkF0SqhkFba9VgtBv81xAHBlwEotPBK/km/UUdTbREmhlfUCARF12oGgDiZi0aBVNXh8M5J+lxPrDFdgLelkQndU26kql14QNWIDYDHMz22q3XfuV8zGCrG1e7ju7z9OZmW/xU6KRYf2n7vLg6PY6rggg/TnDCYN5ArVLRMszoi8RbvRidqBT4QRwDzbwejOvaA+FBu/snkevL36NLw0A2JSp/ZYtzXlZepEJbPG2DYoG6MMfnzY8lvR3kVohZoZs02MbZTTy0J2kUXe4iQpFA6/Q16/CHEAeSA0luC4oNhVkZSSJiWi2VzxorYN57xglrecSfIibcqwd2fIP0eMnHCOQRy92EjVPodQgCwvzBW3ZbRMeVBCtgkb0M7Iei0Yi2FSZm8KbHyNqxyMi82eCSNUMSaGykSeYom5c7tIEMVY/sbfxiB67p0EWdWBq5/i+hGD/pr3gY4jd9PpjHP/uPmyv8H6GoG/T5oZw3Ps1IjQoU80yVZ37C1NV3UJfbAZSlXdCInmskDUIG5iCLED5MEYmf/rgHy3VbNS+AmggWloUyyTmOItrE5/stmvFhYNPM6lxeTRjdPPU9Ve/Xr1ONggA/sCPoQE0wap7mMKPbAAFViIk/Bn+Ji7S3S4VXu36PTnlCUSsEYtarvpLFb1/F+Mndb+5ixD/v/rXnpCdkFWl3H8FejWJ/fuaXCuOUgV9e1n5WlZeMGASEKZXMUj8qy6RfDN7yRZKeQR+xi+8yibpBMcWr8JYneBRZo9cbECHehUqo80BiYNtw3omjF/M5s0eldajzCASsr5hcK0s3l1DTt299pdvGArEkDIs7EA/vccNVIi6c0wZOn7qomzJHjh584UG0vhu30+Xg8sRYOCbbb+I24mZnZiS1ZEXSkqT+AgWqJ4Fupjk1CV6/3y5bI00QTtfgd9cx/rn/1z6KHOnf1Y8z1V4I6rOuTndX4yf737w6yZ12vbkplXB1hSDFElpngPZrfI41eEFXYQGlc5tFNnefRLYSPXaGYW486eSiQXf60ppav6xjvNXfMgx+SdRyf0ogZjQZW2kNG3/CqxIhfqKYUISB9yxO6vkkRJXZrmTN20AiQlVPRv/1KcY/p39NMfh4iszrpslz/FTZ7DFh6iGzpfyEZNnAQPkVwDZkF6UiL/RjQtnzZZZskEDOAQDbucuWakJBarN0DFEswgS6puuQkjT7t9PbGAgPyEMnp9c40oOYitlqBHTIm7ri2diq8gUZsxUBABwGP48Zkes1fCDQmuYoZGI3hx5TNxPNd+AqXfY4BgvTgxEgoCmGMK96kGiQz0kNRYImgcl9sCG6KnlfHTG25icamjVDYqhmQEaktXTBd/FKA2WlO6tPEM63D0Mw1sYVMj6CU9MByMFCJZmy9ONZ/2FO4krErkh8EohWk2YGh4BmWzYrUqq5qK0yHE3cSQEirOm9EQa0HspGbztwhVogYVNX2agNVayCCXzI6dToMLnUBJJPJBMiB97JhYJ0ttozI59rfmCuRwz2CJLZFE7SyE70Nkh4gGObrr86QH6MKUqJLEps54zAyQriWuTRI1YCLe3zRcA4brrrp3CIodramAkf74v6besCbEANNKb1BV27bPiL3GkE1T7fLwXNlSEFltuYuICXFqGKyvtponxPoLfPKBh18MKFNDNWrJqsTOZpatqKYba35CuQpmRQL6+IWOfOIWdUfMDQ2oxA55NTAwcvkr1mxIlVk5EibFF3xrQGhxBy3sIUqhX0uNoYp+bMKOGg9gQfb7/MzYg6J+dtswyVSgmpYp7i906F1i0ZvNcLwfyXkURqI02FTvdEeeJS+7OtE9rjY8zqKCNpJmjyDYQ1u5I0D+JNE6j1qkKNvxG51x6NFHpW+LgPIRjoLhgKMOPA9CiwwtN0xAFuQoAaRDhvboQPWZIM1aQeEGkUgDyEH1nrNEAi6Bj4bxDNJRVmvRVv2f/cZ0E0hXQraGuymPpjlrnAwZ3cC5NwATly11GKZe6nsKZC/AAhapzlE5jQnhIAsMvBnvAOZ1jgbH3DyGmZbWXhK3pzilyyDMGdATrMCdTzjJQl0Mu51xbWbSYyIMSMCDasp6L6cDpqIO4lbN3EwTk3syQfRW0853SRLZNESl7vAV1E6qMZqjvdLHCjxPgadwWtRU+i7STHzMPlyrSdutoi4o0gVYln+YqYZbtso3X/nvPoPCWbTw/REtGjhHvTgoBp08sOJfi6RyoJYr/1VkfRvTgq5oZfzo+hWNALurvuKI6hWFDrqk36LKDqSo9rKQWrwCVWWdlDsLupSMl76ImTidyOTgydSOJNQ6qcWdnkMSMLvvVO6ahaZ7qmzAy3sNAk++WwKtDALiapLxRE1pwZ4qZplJmpFxwHfpYerT6CrTdBsVrbu1UU+UJjMCW+Vg6LIzGhEONsgsYJ6+ZbqhWhHsSrWeZZDtkNtu7rIi9ZWAryVCD4TMyq4f08VRjWjQJLI69T+Hqf/bpiXjtgrt/5ecxCvnwuvOg+6oG/6c5WNFIc+XuIxHsz3pacO+WYs0sxKyUilMdIQ2IUgswYswx22sOMt7cwbqKb1T1DACGa9BFHgvTIyB8B52fGatpzOq8pqw9jfnC4MC8/ZnPYQYsPs7tcNzku1D04GaeqJ3mU+FrPrhO5TkaPegxct64bPIoftcHbj/aknz+IDs+JBtS1qgO1uwOUL+lUaWMPJFh743rtHC0Gtku6bk+K8186VZ+x7QzYA0aDKiiTsgmlrJ12zwF08UHrccnFlLaP1EFW6IcqvdlT25naG+TtWYVILHQeF0dn4yOXBYV8RV4hlnarpoxa18g0MhMT+/05Rpgb8wQ8HOdbX3wYbTj7ptPhNCB6buuq6r48e3tdySigrBf+eoeA1ewHVR1yo5H1xTe7FySZKcbxP1hpzVatlSCavkx5CbAEvmSVZlYqp4mj1HnFxLpXwF0oHN33tvFkA2kzRY16Cqqr4JHQX2L1EJavoR/ycw/nyzd7a+82nuSFs93xHnp7mMj+PRKsZMrYfbcWy0zD0iSobukzVvWMZdVHwVw9mzATpBBJ/v/Sp4XW+7ALt/ALTiEwxIdsf9G/4z/yX4Rn4SD8bP7n6WP9e+2/o/ukeadasse2NvyCter3eqM6vFnz8Dasg2z68BEQiIDiKeVbXp5DlBEbB8ZJNzqZE4Yua4uXrDacLiIw/OUD4A6gArxs2h3b3DAzyK0uKXsc3H9nNZba2Hp3dqsUI/og9P5jiqbO1eypeVkTIa4xXBOtuuZtmzo7vGOOzUt1ejzcdONq/uPiqHrl+magzlezpDOrUqLcCMISrsCG7dIqJOR+bphhe3sdC++i66vZsUEqSC6AmF08/5f5ZAbivEoRDPXKlHmATCVmdKdEAz5TFlU+ySa4t+ZtaWIKthcULB/Y9dIhVqUZyGlFySmUuGa+owzQ/iK2wql3Bo98+BY3my21qVqfSVmmpB+rW+WDYInaJBXupw56Kq7vhOOwpDo/HkbpGhxFOqZI+6pPvoEBfhg8KQSaGcKLHso0uUeykZ32I5rLXU/vaJ3If4Jmeb9+jw1SU57lmvWc5fiZOuryOMe1i6IcHw6PH39MHh71ZGCt8RseItzZ8qTq2XqdwE83TSN5CIFpzWnTuadN5M5QnaZfyc02m8sWbnBDN/+DON0cXiecj18jbhMdZy76FFJixiWzAfnDUDjVY+t6RkSNxzlmF7b27NywoHDWdYp6IZElPB5OT1ZQIyyct+VZKhuf/OCZBPsuJ4+SqKEhHLdz9C7+ZTwejk+UafXTGIbpuZxmywdEGP6SwdUWX2zCE1kbbz6Y4+gNRFLRZAuihTsuCDay76qmUco0TTXhKQ8NmkY1pOFyOOgO0HpCq4QCueuCehkjF3dSTSURf+6fYFowx2z2S2Bypx6myhBqtDCdZv/yZJWs26RQK04+io8EB6uyx5k3BkbRrQenybJOCp+rP3EMaQK4WnQi6vgw3aVD5O7gr0GoOEjY8y71cHN2vNW8eRZd+ib3ZuQiQOLf5TE6Puc1wCi6e9VQLA6E1gEooi1xCjnIXPA9q/5IAtfdvIkwSOLTcH/fjf5ErBJx6cRcOBV0IAQFPf4sz//ni5iS3gDkKxDSG2VSO4VJaoJ88ShojWqQ1ISNC0k91Sq0SaXsuJfSTVnzSf7RH0QSySk5itgFzE3oyZsEmnBqEN7r7OWi9H439cuapEW6E6T0rir+eBcNeFyShzLqZAa7DrYPn68sXZ7iX2wH8GqOYP5GqsyOchrIF01DO1HX6gWjppdtlTkFEpGbIGgrQ1cEyq5E9blJ0pxJZAIypSlOMqzRkgs4baNO9MEW24t8zROmZJAO5skjHtXoO6Pf+SngTyOdfN5XlRiWpQOEGNiRbEDXvPGJIIF6BoEIWT6TcNydrGhrH9JRF0s5ir0sFVqp5I7C/WB/iM9pc9kv38Su7Wvrai93zkxQ+w8TxDCOxzVcFF/kHLvx7h1nhzwT0Tyl0RGiOdmu48X4RHmJVpg9owKHspWzpTcsh1ve2TLi0japT5BXq7b7WJ2uhEJH6GpWoLpQVnVeYb2ybmyI0QhAdfQ2jAHNRFiZjyKbUYIw1H2qANWBLSUz6YyOcNQmit+OwHg88xoYDz2j89HVvbv+13jfGCE+7t7HGNSGuMVBQ2zuuvje2orTcZg19nLKLZvYmngZh9wFqhf4a6fVKH+B8aahgc2FNfOLHQ/jYVtjmjOYpRFgxiY918BC9v99fCF5rcJQ8crJDwqEEUR7g7ONBxiYR+Tz9L47wEpiyMeNxKn08VgmbxBN1MKTX9ESiYsHb2qPCD55lvP/6UbRLJPVBCozSOUUXK5ij52lyxqXW8yM32vCwzLVy1cmDHhDiOom7AsB/tmr+AeGsTR4SPaJjvvlM35lrzL4GXt6QVtmEqfz9n7toW0smhE7V1msHIEbQvvKrlVorKjdluo3BBEBAXK1Rd/6+zs+9lfrd06ZOQDgjZ8EDwD4KGw/LlX/53xjTgQIJxiAAMazZl8AzNliqpoqxg2QJ0znLy2HFxpiNi2SG0jIQno1ZZ7ucvS+y7XrIYQZ3VyUkCvOtFoS5UIjvkquiQtJssT8Xb6kmq7ALdgE62E17I+9sDZ2fbrt08DlPE6jhKhWiYySFdt+6sJ4lln3wNGXk9y12Hes5EoyyONu9AguvUVyUpRWrDNdWEOU6AhDdW82mVaeXQq70E9lHTCuLzrTjUR2TRzDZLV+jEh9Fqw+Q0oNsc0NyG3wtYvItyJQPkClTBnVVaElz6CSGRQZMV+SqkLGdYlfyghO4amuTISmjMThvdCK519MBiEorT4P0FuKeg7gppctHnz9O5Il5FghwIdg02ykmOy6MrJdUYDsz/QOkqqSZ03w7FlsyhR3lqTOgd7uchlM2Ldcme2vvctfYg3csgXT2iQkljnH/Cm15u4pZgvvei+7HTBLfzl5god299Jbq+j218F9lPcgym6I4WKlseRr0snxCrDzoJ+DsAI4023NqHrq6ezqNtOhWi1ySo9+T+GsV4aO3l9L67zSJV+jSg4TDBScg1XUmFSaWqswq6cbnVVVyQ6rR+8CupXK4DysCoB/rbAl8Dzj4xi3UQ051uHbD8Vnu5j2RFQJA3EvAH1BFYOE4HjFj3KP45cMmi5GM0ZsGgzytfR+IO2+Aveh1yATBWUA61ZIOn8KV+UcO5/IClcMMGcL9ABAfU24dkiNwdOx+b/UcDomYEWMw8bYxMb6pjfMnyLAvchMYBEYggB/McDGAAIEYEEgga/BQYCFzTwObLpRjiP7opqSEHBTGh4aG9d2SodiZA6IOFTjn+PR7F9zAcfIoadAeO1PgeH0fQqciD97RExhcyqEp7ATCfyF+NmFdZZfKI/PP5zZnK5ZETn/oVrZeZ3/j8Drn7lO0E9ax/uCa4Q+sECvcr5UaXSOYjX2KLlQNnco3ZwlMlE21KLMoWLIMb/wt8gauYcPpwgTFJPyIJ0hwCkrKlUTOAuUadSmzrhCyPLm6IDtyDlA+pan8hvPEzlPkT94lEQ4wOMz2pRBhGvJe4jnQ0hSPc53VTR0otm0EVaRg6o1l2baChWJ03ki5kw5EqzKozx6rg3JVCTKe+Mr2FqZmNm7mMlVmiriCRhzhNMAXrb1FxAZLQo8Y/ubjBMXbjx48eEnAEmQEBRhx4gQJeY4cRIkSZEmAw1DlpwTTjqVxzj3PHkXKLiYbkQ5p7Gp5qRGy9Zq5erRZ8CQ0b2HiSTmOjbN3IIWLFmxznn8r4QdCnsOqBzROKFz5sKVG/dg0yBVmhFldjHlyXZDm8Zgl+WpFMXBEXPkKpfhnpfBpVq7b776rl6X+2Z18+CpgJcHvM2Zt+ihfyzY42PVkmU9fH1SaN2aR/wceC9TAH+BggUJUStUGIZwEaJEihZjX6xL4sS7LMFNda5IlOSqQx/ctoGlN7g99sKT4In5YwF9+g0ZNmXAoGnpOoI/FjJqzN1AhqAcT/krBnIKSipqGja0dPQMjEzMbNmxsOeEU84456Lz+fIJFovF4otup8wo71rT5aBRMWTHxmWoFdIaVh5PoDz+ALXVMH4pv269ZCHnHr9Rffq0i7CTms/mc8U4Nv06TORLwSXeNB5HirpIbPQBbnjAB21vQUzzWeVSb5SoK/Ges11vyI/c5/wOKInOASXTOXm4j4n8KADPG3pGd5I/IUE2KE3HjwFrDgBA73LwAQeAA7qPcENlrgRXDqS1nftE97fSXo3E1Sd++831vFWLEHcm+u23HzfLTOwLfz4uhpmSk3TQLGf4Wy8uZ+SZxO3hyqDeIp/sqZnUhz9uLocz6H+/VfuZ934Oo+2doHTXEtyzTPJD36Lnhym+hT7VuvGm4ig+DuWbKA5TvFf5pHKn/ED5P5p0srKhDVDvmifGJ6GtYS3+CjT5io9r5U75jfJ/8SZKdWzFJ1EVZ3b0Zy8BAA==') format('woff2');
      unicode-range: U+0000-00FF, U+0131, U+0152-0153, U+02BB-02BC, U+02C6, U+02DA, U+02DC, U+2000-206F, U+2074, U+20AC, U+2122, U+2191, U+2193, U+2212, U+2215, U+FEFF, U+FFFD;
    }



      /* GENERAL */
      [href]:focus, [tabindex]:focus, input:not([disabled]):focus, select:not([disabled]):focus, button:not([disabled]):focus {
        outline: 2px dotted #aeb0b5;
        outline-offset: 3px;
      }

      body,html {
          height: 100%;
          height: auto; /* IE 11 Fix */
          min-height: 100%;
          overflow-x: hidden;
      }
      body {
        margin: 0;
        display: -webkit-box;
        display: -ms-flexbox;
        display: flex;
        -webkit-box-orient: vertical;
        -webkit-box-direction: normal;
        -ms-flex-direction: column;
        flex-direction: column;
        margin: 0;
        background-color: #fff;
        font-family: "Roboto", "Helvetica Neue", Arial, Tahoma;
        color: rgba(27,27,27,1);
        font-size: 1.09rem;
      }
      main {
        -webkit-box-flex: 1 0 auto;
        -ms-flex: 1 0 auto;
        flex: 1 0 auto;
        padding: 20px 10px;
      }
      @media (min-width: 480px) {
        main {
          padding: 20px 40px;
        }
      }

      @media (min-width: 992px) {
        main {
          padding: 40px 83px;
        }
      }

      .bg-primary {
          color: #ffffff;
      }
      .text-white {
        color: #ffffff !important;
      }
      .container {
        width: 100%;
        padding-right: 15px;
        padding-left: 15px;
        margin-right: auto;
        margin-left: auto;
      }

      @media (min-width: 992px) {
        .container {
          max-width: 980px;
        }
      }

      .container-fluid {
        width: 100%;
        margin-right: auto;
        margin-left: auto;
      }

      .row {
        display: -webkit-box;
        display: -ms-flexbox;
        display: flex;
        -ms-flex-wrap: wrap;
        flex-wrap: wrap;
        margin-right: -15px;
        margin-left: -15px;
      }

      .col-12,.col,
      .col-lg-3,
      .col-lg-12,
      .col-lg,
      .col-xl-auto {
        position: relative;
        width: 100%;
        min-height: 1px;
        padding-right: 15px;
        padding-left: 15px;
      }
      .col-12 {
        -webkit-box-flex: 0;
        -ms-flex: 0 0 100%;
        flex: 0 0 100%;
        max-width: 100%;
      }

      .list-inline {
        padding-left: 0;
        list-style: none;
      }

      ol,
      ul,
      dl {
        margin-top: 0;
        margin-bottom: 1rem;
      }

    /* SKIPNAV */
    .usa-skipnav{
        font-family: "Roboto", "Helvetica Neue", Arial, Tahoma;
        font-size:1.06rem;
        line-height:1.5;
        background:transparent;
        left:0;
        padding:0.5rem 1rem;
        position:absolute;
        top:-3.8rem;
        -webkit-transition:all 0.2s ease-in-out;
        transition:all 0.2s ease-in-out;
        z-index:100;
    }
    .usa-skipnav:focus{
        background:white;
        left:0;
        position:absolute;
        top:0;
        -webkit-transition:all 0.2s ease-in-out;
        transition:all 0.2s ease-in-out;
    }

      /* HEADER */
html {
  box-sizing: border-box; }

*, *::after, *::before {
  box-sizing: inherit; }

.ncbi-header {
  background-color: #20558a;
  z-index: 10;
  padding: 14px 0 10px 0; }
  .ncbi-header a {
    color: inherit;
    text-decoration: none; }
  .ncbi-header a:hover {
    color: #ffffff;
    text-decoration: underline; }
  .ncbi-header .ncbi-header__logo {
    width: auto;
    float: left; }
  .ncbi-header .header-button {
    width: auto;
    margin: 1.5rem 0.3rem;
    background-color: transparent;
    color: #ffffff;
    border: 1px solid rgba(255, 255, 255, 0.5);
    font-size: 1.4rem;
    font-weight: normal;
    white-space: nowrap;
    padding: 0.8rem; }
    .ncbi-header .header-button:hover {
      background-color: #0071bc;
      text-decoration: none; }
    .ncbi-header .header-button .fa {
      margin: 0; }
    @media screen and (min-width: 600px) {
      .ncbi-header .header-button {
        font-size: 1.7rem; }
        .ncbi-header .header-button .fa {
          margin: 0 0.2rem; } }
    @media screen and (min-width: 1201px) {
      .ncbi-header .header-button {
        padding: 1rem 2rem; }
        .ncbi-header .header-button .fa {
          margin-left: 0;
          margin-right: 0.5rem; } }
  .ncbi-header .desktop-only {
    display: none; }
    @media screen and (min-width: 600px) {
      .ncbi-header .desktop-only {
        display: inherit; } }
  .ncbi-header .account-old {
    float: left;
    display: block;
    font-size: 1.4rem;
    position: relative;
    width: 30%;
    text-align: right; }
    @media screen and (min-width: 600px) {
      .ncbi-header .account-old {
        width: 30%;
        font-size: 1.7rem; } }
  .ncbi-header .logo {
    width: 245px;
    margin-top: 13px;
    margin-right: 10px;
    display: inline-block;
    margin-bottom: 5px; }
    @media (min-width: 375px) {
      .ncbi-header .logo {
        width: 280px;
        height: 42px; } }
    @media (min-width: 640px) {
      .ncbi-header .logo {
        width: 414px;
        height: 63px;
        margin-bottom: 0; } }



      /* MAIN */
      /* Title */
      h1, h2 {
        font-family: "Roboto", "Helvetica Neue", Arial, Tahoma;
      }
      h1 {
        color: #205493;
        font-size: 6rem;
        line-height: 0rem;
        margin-top:2.5rem;
      }
      h2 {
        font-size: 1.6rem;
        margin-top: 15px;
      }

      @media (min-width: 480px){
        h1 {
          font-size: 8rem;
          line-height: 0.5rem;
          margin-top:3rem;
        }
        h2 {
          font-size: 2rem;
          margin-top: 40px;
        }
      }

      /* Content */

      @media (min-width: 640px) and (max-width: 991px) {
        .flex-child, .flex-child ul li {
          text-align: center;
          margin-right: auto;
          margin-left: auto;
        }
        .flex-child:not(:last-child), .flex-child ul li:not(:last-child)  {
          margin-bottom: 20px !important;
        }

      }

      @media (min-width: 992px) {
        .usa-search {
          margin-right: -5px;
        }
      }

      .usa-button{
        display: block;
        margin: 1em auto;
      }

      .usa-search {
        -webkit-box-pack: center;
        -ms-flex-pack: center;
        justify-content: center;
      }

      .usa-input  {
        height:2.45em;
        width: 100%;
        border: 1px solid #666666;
      }
      .usa-button__search {
        height: 2.32em!important;
      }

      @media (min-width: 480px) {
        .usa-input {
          width: 60%;
          max-width: 300px;
        }
      }
      @media (min-width: 640px) {
        .usa-button {
          display: inline-block;
          margin: 0 1em 0 0;
        }
      }
      @media (min-width: 992px) {
        .usa-input {
          width: calc(100% - 92px);
          max-width: none;
        }
      }
      .usa-button span{
        display: none;
      }
      @media all and (min-width: 480px){
        .usa-button span{
          display: inline-block;
        }
      }


      /* FOOTER */
footer {
  margin-top: auto;
  letter-spacing: 0.5px; }
  footer ol, footer ul, footer dl {
    margin-top: 0;
    margin-bottom: 1rem; }
  footer .social_media a {
    width: 35px;
    height: 35px;
    display: inline-block;
    margin-right: 5px; }
  footer .pt-5, footer .py-5 {
    padding-top: 1rem; }
    @media (min-width: 992px) {
      footer .pt-5, footer .py-5 {
        padding-top: 3rem; } }
  footer .bottom-links {
    margin: 0 auto; }
  footer .bottom-links ul {
    list-style: none;
    padding-left: 0px;
    display: -webkit-inline-box;
    display: -ms-inline-flexbox;
    display: inline-flex;
    -webkit-box-orient: horizontal;
    -webkit-box-direction: normal;
    -ms-flex-direction: row;
    flex-direction: row;
    -ms-flex-wrap: nowrap;
    flex-wrap: nowrap;
    -webkit-box-pack: center;
    -ms-flex-pack: center;
    justify-content: center; }
  footer .bottom-links ul li {
    padding: 0px 8px;
    position: relative;
    font-size: 18px; }
  footer .bottom-links ul li:first-child {
    padding-left: 0px; }
  footer .bottom-links ul li:not(:last-child) {
    border-right: 1px solid #FFFFFF; }

@media (min-width: 992px) {
  .col-lg-3 {
    -webkit-box-flex: 0;
    -ms-flex: 0 0 25%;
    flex: 0 0 25%;
    max-width: 25%; }
  .col-lg-12 {
    -webkit-box-flex: 0;
    -ms-flex: 0 0 100%;
    flex: 0 0 100%;
    max-width: 100%; }
  .centered-lg {
    display: -webkit-box;
    display: -ms-flexbox;
    display: flex;
    -webkit-box-pack: center;
    -ms-flex-pack: center;
    justify-content: center; } }

.icon_social {
  width: 35px;
  height: 35px;
  display: inline-block;
  margin-right: 5px;
  margin-bottom: 1rem; }

.icon-section {
  background-color: #dbdbdb; }

.icon-section_header {
  background-color: #90a6c7;
  text-align: center;
  color: #fff;
  text-transform: uppercase;
  font-size: 18px;
  font-weight: bold;
  padding: 16px;
  margin-top: 50px; }

.icon-section_header::after {
  display: none;
  content: "";
  border: solid #fff;
  border-width: 0px 3px 3px 0px;
  padding: 7px;
  -ms-transform: rotate(45deg);
  transform: rotate(45deg);
  -webkit-transform: rotate(45deg);
  margin-left: 15px;
  position: absolute;
  margin-top: -2px; }

.icon-section_header.opened::after {
  -ms-transform: rotate(-135deg);
  transform: rotate(-135deg);
  -webkit-transform: rotate(-135deg);
  margin-top: 6px; }

.icon-section_container {
  display: -webkit-box;
  display: -ms-flexbox;
  display: flex;
  -webkit-box-pack: justify;
  -ms-flex-pack: justify;
  justify-content: space-between; }

.icon-section_header.opened + .grid-container .icon-section_container {
  display: -webkit-box;
  display: -ms-flexbox;
  display: flex; }

.footer-icon {
  display: block;
  width: 40px;
  height: 40px;
  margin: 20px 0; }

/* Added after adding USWDS */
.bg-primary {
  background-color: #20558A; }

.icon-section_header {
  background-color: #4773aa; }


      footer p {
        line-height: 1.5em;
        margin-top: 0;
        margin-bottom: 10px;
      }
      @media (min-width: 992px) {
        footer .pt-5,
        footer .py-5 {
          padding-top: 30px;
        }
      }
      footer .mt-3,
      footer .my-3 {
        margin-top: 10px;
      }
      footer .mt-3 li {
        margin-bottom: 0.3em;
      }

      /* ADDITIONAL NWDS OVERRIDES */
      .usa-grid{
          margin-left:auto;
          margin-right:auto;
          padding-right:15px;
          padding-left:15px;
        }

        .usa-grid::after{
          clear:both;
          content:"";
          display:block;
        }

        @media screen and (min-width: 600px) {
          .usa-grid{
            padding-right:30px;
            padding-left:30px;
          }
        }


        @media screen and (min-width: 992px) {
          .usa-grid {
            max-width:980px;
          }

        }

      .list-inline {
        padding-left: 0;
        list-style: none;
      }
      .list-inline-item {
        display: inline-block;
      }
      a {
        text-decoration: none;
      }
      </style>
</head>
<body >
    <a class="usa-skipnav" href="#main_content">Skip to main content</a>
    <section class="usa-banner">
      <div class="usa-accordion">
        <header class="usa-banner-header">
          <div class="usa-grid usa-banner-inner">
            <img src="https://www.ncbi.nlm.nih.gov/coreutils/uswds/img/favicons/favicon-57.png" alt="U.S. flag" />
            <p>An official website of the United States government</p>
            <button
                    class="usa-accordion-button usa-banner-button"
                    aria-expanded="false"
                    aria-controls="gov-banner-top"
            >
              <span class="usa-banner-button-text">Here's how you know</span>
            </button>
          </div>
        </header>
        <div
                class="usa-banner-content usa-grid usa-accordion-content"
                id="gov-banner-top"
        >
          <div class="usa-banner-guidance-gov usa-width-one-half">
            <img
                    class="usa-banner-icon usa-media_block-img"
                    src="https://www.ncbi.nlm.nih.gov/coreutils/uswds/img/icon-dot-gov.svg"
                    alt="Dot gov"
            />
            <div class="usa-media_block-body">
              <p>
                <strong>The .gov means it’s official.</strong>
                <br />
                Federal government websites often end in .gov or .mil. Before
                sharing sensitive information, make sure you’re on a federal
                government site.
              </p>
            </div>
          </div>
          <div class="usa-banner-guidance-ssl usa-width-one-half">
            <img
                    class="usa-banner-icon usa-media_block-img"
                    src="https://www.ncbi.nlm.nih.gov/coreutils/uswds/img/icon-https.svg"
                    alt="Https"
            />
            <div class="usa-media_block-body">
              <p>
                <strong>The site is secure.</strong>
                <br />
                The <strong>https://</strong> ensures that you are connecting to the
                official website and that any information you provide is encrypted
                and transmitted securely.
              </p>
            </div>
          </div>
        </div>
      </div>
    </section>
    <div class="usa-overlay"></div>
    <header class="ncbi-header bg-primary">
      <div class="usa-grid">
          <div class="usa-width-one-whole">
          <div class="ncbi-header__logo">
            <a href="https://www.ncbi.nlm.nih.gov/" class="logo" aria-label="NCBI Logo">
              <svg xmlns="http://www.w3.org/2000/svg" viewBox="0 0 2039.55 243.26">
                <defs>
                  <style>
                    .cls-1 {
                      fill: #fff!important;
                    }
                  </style>
                </defs>
                <g id="Layer_2" data-name="Layer 2">
                  <g id="Text_outlines" data-name="Text outlines">
                    <path class="cls-1"
                      d="M266.77,67.24V176H248.18v-49.2H199.53V176H180.4V67.24H199v43.19h48.66V67.24ZM161.26,176H142.68V67.24h18.58Zm-37.17,0H104.41L55.76,96.21h-.55V176h-18V67.24H56.85l49.2,79.81h.55V67.24h18V176Zm208.83-54.66L266.77,0H21.87A22.05,22.05,0,0,0,0,22.41V220.85a22.05,22.05,0,0,0,21.87,22.41H266.22Z" />
                    <path class="cls-1"
                      d="M283.17,242.72l66.69-121.36L283.17,0h16.4c9.29,0,20.23,6.56,24.6,14.76l58.49,106.6L324.17,228c-4.37,8.2-15.31,14.76-24.6,14.76Z" />
                    <path class="cls-1"
                      d="M428.15,31.14h16.5L485.4,96.89h.25V31.14h14.88v89.25H484L443.4,54.76H443v65.63H428.15Z" />
                    <path class="cls-1"
                      d="M571.15,106a7.54,7.54,0,0,0,.69,3.75,2.9,2.9,0,0,0,2.69,1.13H576a9.16,9.16,0,0,0,2-.25v9.87c-.5.17-1.15.36-1.94.57s-1.61.39-2.44.56-1.67.29-2.5.37a20,20,0,0,1-2.12.13,13.78,13.78,0,0,1-7.25-1.75q-2.88-1.76-3.75-6.13a25.29,25.29,0,0,1-10.44,6,41.17,41.17,0,0,1-11.94,1.88,29.25,29.25,0,0,1-8.37-1.19,22,22,0,0,1-7.07-3.5,16.81,16.81,0,0,1-4.87-5.87,18.11,18.11,0,0,1-1.81-8.32,19.18,19.18,0,0,1,2.18-9.75,16.27,16.27,0,0,1,5.75-5.87,25.79,25.79,0,0,1,8-3.06,90.4,90.4,0,0,1,8.94-1.44,70.49,70.49,0,0,1,7.38-1.06A34.66,34.66,0,0,0,552,81a9.49,9.49,0,0,0,4.25-2.31A6.37,6.37,0,0,0,557.78,74a7.28,7.28,0,0,0-1.32-4.5,8.78,8.78,0,0,0-3.25-2.68,13.68,13.68,0,0,0-4.31-1.25,34.25,34.25,0,0,0-4.5-.32,17.93,17.93,0,0,0-9.87,2.5,9.74,9.74,0,0,0-4.38,7.75H515.9a21.45,21.45,0,0,1,3-10.37,20.76,20.76,0,0,1,6.69-6.63,27.57,27.57,0,0,1,9.19-3.5,55.13,55.13,0,0,1,10.5-1,44.65,44.65,0,0,1,9.37,1A26.74,26.74,0,0,1,563,58.26a18,18,0,0,1,5.94,5.82,15.93,15.93,0,0,1,2.25,8.68ZM556.9,88a17.36,17.36,0,0,1-8,2.57c-3.17.29-6.33.73-9.5,1.31A30,30,0,0,0,535,93a12.93,12.93,0,0,0-3.75,1.88A8.22,8.22,0,0,0,528.71,98a10.78,10.78,0,0,0-.93,4.69,6,6,0,0,0,1.37,4,10,10,0,0,0,3.31,2.56,15.17,15.17,0,0,0,4.25,1.31,26.44,26.44,0,0,0,4.19.38,23.14,23.14,0,0,0,5.13-.63,16.81,16.81,0,0,0,5.18-2.12,13.72,13.72,0,0,0,4.07-3.81,9.69,9.69,0,0,0,1.62-5.69Z" />
                    <path class="cls-1"
                      d="M580,55.76h10.75V36.39H605V55.76H617.9V66.39H605v34.5a35.69,35.69,0,0,0,.18,3.87,6.71,6.71,0,0,0,.88,2.75,4.15,4.15,0,0,0,2.06,1.69,10.07,10.07,0,0,0,3.75.56q1.5,0,3-.06a14.79,14.79,0,0,0,3-.44v11l-4.62.5a41.2,41.2,0,0,1-4.63.25,31.47,31.47,0,0,1-9.06-1.06,12.17,12.17,0,0,1-5.38-3.12,10.85,10.85,0,0,1-2.62-5.19,38.6,38.6,0,0,1-.81-7.13V66.39H580Z" />
                    <path class="cls-1" d="M628.52,31.14h14.25v13.5H628.52Zm0,24.62h14.25v64.63H628.52Z" />
                    <path class="cls-1"
                      d="M687.9,122.14a35.31,35.31,0,0,1-13.81-2.56,29.4,29.4,0,0,1-10.25-7.07,30.09,30.09,0,0,1-6.38-10.75,43.85,43.85,0,0,1,0-27.37,30.09,30.09,0,0,1,6.38-10.75,29.25,29.25,0,0,1,10.25-7.06,38.39,38.39,0,0,1,27.62,0A29.34,29.34,0,0,1,712,63.64a30.24,30.24,0,0,1,6.38,10.75,44,44,0,0,1,0,27.37A30.24,30.24,0,0,1,712,112.51a29.5,29.5,0,0,1-10.25,7.07A35.31,35.31,0,0,1,687.9,122.14Zm0-11.25a16.37,16.37,0,0,0,8.25-2,17.35,17.35,0,0,0,5.75-5.25,23,23,0,0,0,3.31-7.31,32.91,32.91,0,0,0,0-16.57,22.18,22.18,0,0,0-3.31-7.31,17.83,17.83,0,0,0-5.75-5.19,18,18,0,0,0-16.5,0,17.83,17.83,0,0,0-5.75,5.19,22,22,0,0,0-3.31,7.31,32.61,32.61,0,0,0,0,16.57,22.83,22.83,0,0,0,3.31,7.31,17.35,17.35,0,0,0,5.75,5.25A16.37,16.37,0,0,0,687.9,110.89Z" />
                    <path class="cls-1"
                      d="M732.4,55.76h13.5v9.5l.25.25a23.83,23.83,0,0,1,8.5-8.43A22.56,22.56,0,0,1,766.27,54q10.62,0,16.75,5.5T789.15,76v44.38H774.9V79.76q-.25-7.62-3.25-11.06t-9.38-3.44a15.41,15.41,0,0,0-6.5,1.32,14,14,0,0,0-4.87,3.62,17,17,0,0,0-3.13,5.44,19.38,19.38,0,0,0-1.12,6.62v38.13H732.4Z" />
                    <path class="cls-1"
                      d="M858.27,106a7.54,7.54,0,0,0,.69,3.75,2.9,2.9,0,0,0,2.69,1.13h1.5a9.16,9.16,0,0,0,2-.25v9.87c-.5.17-1.15.36-1.94.57s-1.61.39-2.44.56-1.67.29-2.5.37a20,20,0,0,1-2.12.13,13.78,13.78,0,0,1-7.25-1.75q-2.88-1.76-3.75-6.13a25.29,25.29,0,0,1-10.44,6,41.17,41.17,0,0,1-11.94,1.88A29.25,29.25,0,0,1,814.4,121a22.07,22.07,0,0,1-7.07-3.5,16.81,16.81,0,0,1-4.87-5.87,18.11,18.11,0,0,1-1.81-8.32,19.29,19.29,0,0,1,2.18-9.75,16.27,16.27,0,0,1,5.75-5.87,25.89,25.89,0,0,1,8-3.06,90.4,90.4,0,0,1,8.94-1.44,70.49,70.49,0,0,1,7.38-1.06A34.66,34.66,0,0,0,839.08,81a9.43,9.43,0,0,0,4.25-2.31A6.33,6.33,0,0,0,844.9,74a7.28,7.28,0,0,0-1.32-4.5,8.7,8.7,0,0,0-3.25-2.68A13.68,13.68,0,0,0,836,65.58a34.25,34.25,0,0,0-4.5-.32,17.93,17.93,0,0,0-9.87,2.5,9.74,9.74,0,0,0-4.38,7.75H803a21.45,21.45,0,0,1,3-10.37,20.76,20.76,0,0,1,6.69-6.63A27.57,27.57,0,0,1,821.9,55a55.13,55.13,0,0,1,10.5-1,44.65,44.65,0,0,1,9.37,1,26.65,26.65,0,0,1,8.31,3.25A18,18,0,0,1,856,64.08a15.93,15.93,0,0,1,2.25,8.68ZM844,88a17.36,17.36,0,0,1-8,2.57c-3.17.29-6.33.73-9.5,1.31A30,30,0,0,0,822.15,93a12.93,12.93,0,0,0-3.75,1.88A8.22,8.22,0,0,0,815.83,98a10.78,10.78,0,0,0-.93,4.69,6,6,0,0,0,1.37,4,10,10,0,0,0,3.31,2.56,15.27,15.27,0,0,0,4.25,1.31,26.55,26.55,0,0,0,4.19.38,23.14,23.14,0,0,0,5.13-.63,16.81,16.81,0,0,0,5.18-2.12,13.72,13.72,0,0,0,4.07-3.81A9.69,9.69,0,0,0,844,98.64Z" />
                    <path class="cls-1" d="M874,31.14h14.25v89.25H874Z" />
                    <path class="cls-1" d="M940.52,31.14h15.63v75.75h45.37v13.5h-61Z" />
                    <path class="cls-1" d="M1010.65,31.14h14.25v13.5h-14.25Zm0,24.62h14.25v64.63h-14.25Z" />
                    <path class="cls-1"
                      d="M1040.77,31.14H1055v33h.25a19.61,19.61,0,0,1,3.63-4.25,22.61,22.61,0,0,1,4.68-3.19,24.84,24.84,0,0,1,5.38-2,23.25,23.25,0,0,1,5.56-.69,30.88,30.88,0,0,1,13.31,2.69,26.21,26.21,0,0,1,9.44,7.38A32,32,0,0,1,1102.9,75a46.38,46.38,0,0,1,1.87,13.38,47.08,47.08,0,0,1-1.69,12.62,32.79,32.79,0,0,1-5.12,10.82,25,25,0,0,1-21.06,10.31,50.47,50.47,0,0,1-6.57-.44A24.4,24.4,0,0,1,1064,120a21.45,21.45,0,0,1-5.44-3.25,15.76,15.76,0,0,1-4.06-5.25h-.25v8.88h-13.5Zm49.75,57a32.14,32.14,0,0,0-1.12-8.5,23,23,0,0,0-3.38-7.31,17.35,17.35,0,0,0-5.62-5.13,15.32,15.32,0,0,0-7.75-1.94q-9,0-13.57,6.25t-4.56,16.63a33.14,33.14,0,0,0,1.19,9.06,20.45,20.45,0,0,0,3.56,7.19,17.79,17.79,0,0,0,5.69,4.75,16.19,16.19,0,0,0,7.69,1.75,16,16,0,0,0,8.25-2,17.37,17.37,0,0,0,5.56-5.19,20.85,20.85,0,0,0,3.12-7.25A36.57,36.57,0,0,0,1090.52,88.14Z" />
                    <path class="cls-1"
                      d="M1116.77,55.76h13.37v12.5h.25a14.47,14.47,0,0,1,2.44-5.12,23.55,23.55,0,0,1,4.38-4.56,22.05,22.05,0,0,1,5.68-3.32,17.13,17.13,0,0,1,6.38-1.25,31.47,31.47,0,0,1,3.44.13l1.93.25V68.14c-1-.17-2-.31-3.06-.44a26.73,26.73,0,0,0-3.06-.19,16.32,16.32,0,0,0-6.81,1.44,15.76,15.76,0,0,0-5.57,4.25,21,21,0,0,0-3.75,6.94,30.24,30.24,0,0,0-1.37,9.5v30.75h-14.25Z" />
                    <path class="cls-1"
                      d="M1214.89,106a7.54,7.54,0,0,0,.69,3.75,2.9,2.9,0,0,0,2.69,1.13h1.5a9.16,9.16,0,0,0,2-.25v9.87c-.5.17-1.15.36-1.94.57s-1.6.39-2.44.56-1.66.29-2.5.37a20,20,0,0,1-2.12.13,13.78,13.78,0,0,1-7.25-1.75q-2.88-1.76-3.75-6.13a25.22,25.22,0,0,1-10.44,6,41.07,41.07,0,0,1-11.94,1.88A29.3,29.3,0,0,1,1171,121a21.91,21.91,0,0,1-7.06-3.5,16.73,16.73,0,0,1-4.88-5.87,18.11,18.11,0,0,1-1.81-8.32,19.18,19.18,0,0,1,2.19-9.75,16.11,16.11,0,0,1,5.75-5.87,25.69,25.69,0,0,1,8-3.06,89.73,89.73,0,0,1,8.93-1.44,70.87,70.87,0,0,1,7.38-1.06,34.94,34.94,0,0,0,6.19-1.07A9.54,9.54,0,0,0,1200,78.7a6.37,6.37,0,0,0,1.56-4.69,7.34,7.34,0,0,0-1.31-4.5,8.86,8.86,0,0,0-3.25-2.68,13.74,13.74,0,0,0-4.32-1.25,34.25,34.25,0,0,0-4.5-.32,17.93,17.93,0,0,0-9.87,2.5,9.76,9.76,0,0,0-4.38,7.75h-14.25a21.45,21.45,0,0,1,3-10.37,20.76,20.76,0,0,1,6.69-6.63,27.57,27.57,0,0,1,9.19-3.5,55.13,55.13,0,0,1,10.5-1,44.65,44.65,0,0,1,9.37,1,26.71,26.71,0,0,1,8.32,3.25,18,18,0,0,1,5.93,5.82,15.93,15.93,0,0,1,2.25,8.68Zm-14.25-18a17.32,17.32,0,0,1-8,2.57q-4.74.44-9.5,1.31a30,30,0,0,0-4.37,1.06,12.93,12.93,0,0,0-3.75,1.88,8.1,8.1,0,0,0-2.56,3.12,10.63,10.63,0,0,0-.94,4.69,6,6,0,0,0,1.37,4,9.94,9.94,0,0,0,3.32,2.56,15.07,15.07,0,0,0,4.25,1.31,26.33,26.33,0,0,0,4.18.38,23.07,23.07,0,0,0,5.13-.63,17,17,0,0,0,5.19-2.12,13.8,13.8,0,0,0,4.06-3.81,9.69,9.69,0,0,0,1.62-5.69Z" />
                    <path class="cls-1"
                      d="M1230.27,55.76h13.37v12.5h.25a14.47,14.47,0,0,1,2.44-5.12,23.55,23.55,0,0,1,4.38-4.56,22.05,22.05,0,0,1,5.68-3.32,17.13,17.13,0,0,1,6.38-1.25,31.6,31.6,0,0,1,3.44.13l1.93.25V68.14c-1-.17-2-.31-3.06-.44a26.73,26.73,0,0,0-3.06-.19,16.32,16.32,0,0,0-6.81,1.44,15.76,15.76,0,0,0-5.57,4.25,21,21,0,0,0-3.75,6.94,30.24,30.24,0,0,0-1.37,9.5v30.75h-14.25Z" />
                    <path class="cls-1"
                      d="M1267.14,55.76h15.63L1299.64,104h.25l16.38-48.25h14.87L1306,123.89c-1.17,2.91-2.31,5.71-3.44,8.37a30.11,30.11,0,0,1-4.12,7.07,17.89,17.89,0,0,1-6.07,4.87,20.62,20.62,0,0,1-9.25,1.81,64.81,64.81,0,0,1-9.87-.75v-12c1.16.17,2.29.36,3.37.57a18.63,18.63,0,0,0,3.38.31,11.51,11.51,0,0,0,4.12-.63,6.74,6.74,0,0,0,2.69-1.81,11.22,11.22,0,0,0,1.81-2.81,28.64,28.64,0,0,0,1.38-3.75l1.62-5Z" />
                    <path class="cls-1"
                      d="M1403.52,122.14a35.31,35.31,0,0,1-13.81-2.56,29.4,29.4,0,0,1-10.25-7.07,30.09,30.09,0,0,1-6.38-10.75,43.85,43.85,0,0,1,0-27.37,30.09,30.09,0,0,1,6.38-10.75,29.25,29.25,0,0,1,10.25-7.06,38.39,38.39,0,0,1,27.62,0,29.34,29.34,0,0,1,10.25,7.06A30.24,30.24,0,0,1,1434,74.39a44,44,0,0,1,0,27.37,30.24,30.24,0,0,1-6.38,10.75,29.5,29.5,0,0,1-10.25,7.07A35.35,35.35,0,0,1,1403.52,122.14Zm0-11.25a16.42,16.42,0,0,0,8.25-2,17.35,17.35,0,0,0,5.75-5.25,23,23,0,0,0,3.31-7.31,32.91,32.91,0,0,0,0-16.57,22.18,22.18,0,0,0-3.31-7.31,17.83,17.83,0,0,0-5.75-5.19,18,18,0,0,0-16.5,0,17.73,17.73,0,0,0-5.75,5.19,22,22,0,0,0-3.31,7.31,32.61,32.61,0,0,0,0,16.57,22.83,22.83,0,0,0,3.31,7.31,17.25,17.25,0,0,0,5.75,5.25A16.37,16.37,0,0,0,1403.52,110.89Z" />
                    <path class="cls-1"
                      d="M1441.64,55.76h10.63V50.39a27.59,27.59,0,0,1,1.5-9.94,14,14,0,0,1,4-5.87,13,13,0,0,1,5.68-2.75,31.62,31.62,0,0,1,6.69-.69,41,41,0,0,1,10,.87V43.14a19.9,19.9,0,0,0-2.94-.56,30.26,30.26,0,0,0-3.68-.19,8.73,8.73,0,0,0-4.94,1.37c-1.38.92-2.06,2.71-2.06,5.38v6.62h12.12V66.39h-12.12v54h-14.25v-54h-10.63Z" />
                    <path class="cls-1"
                      d="M1523.89,31.14h22L1570.51,101h.25l24-69.87h21.75v89.25h-14.87V51.51h-.25l-24.75,68.88h-12.88L1539,51.51h-.25v68.88h-14.87Z" />
                    <path class="cls-1"
                      d="M1644.39,91.76a24.75,24.75,0,0,0,1.06,7.25,17.8,17.8,0,0,0,3.19,6.13,15.45,15.45,0,0,0,5.37,4.19,17.77,17.77,0,0,0,7.75,1.56q6.26,0,10.07-2.69a15.89,15.89,0,0,0,5.68-8.06H1691a26.76,26.76,0,0,1-10.5,16.31,28.53,28.53,0,0,1-8.68,4.25,35,35,0,0,1-10.07,1.44,34.36,34.36,0,0,1-13.5-2.5,27.91,27.91,0,0,1-9.93-7,29.73,29.73,0,0,1-6.13-10.75,43.83,43.83,0,0,1-2.06-13.75,38.84,38.84,0,0,1,2.19-13.06,33.28,33.28,0,0,1,6.25-10.88A29.3,29.3,0,0,1,1661.39,54a29.07,29.07,0,0,1,13.69,3.19,30.14,30.14,0,0,1,10.06,8.44A34.3,34.3,0,0,1,1691,77.7a37,37,0,0,1,.94,14.06Zm33.25-9.37a23.13,23.13,0,0,0-1.44-6.5,17.23,17.23,0,0,0-3.25-5.44,16.07,16.07,0,0,0-5-3.75,14.72,14.72,0,0,0-6.56-1.44,17,17,0,0,0-6.81,1.32,15.36,15.36,0,0,0-5.25,3.62,17.84,17.84,0,0,0-3.5,5.44,18.76,18.76,0,0,0-1.44,6.75Z" />
                    <path class="cls-1"
                      d="M1763.64,120.39h-13.5v-8.75h-.25a16.91,16.91,0,0,1-8.38,8.06,28.26,28.26,0,0,1-11.62,2.44,30.85,30.85,0,0,1-13.31-2.69,26.5,26.5,0,0,1-9.44-7.31,31.27,31.27,0,0,1-5.63-10.94,47.43,47.43,0,0,1-1.87-13.56A43.46,43.46,0,0,1,1702,72.51a30.33,30.33,0,0,1,6.32-10.5,24.3,24.3,0,0,1,9-6.06A28.64,28.64,0,0,1,1727.64,54a34,34,0,0,1,6.12.57,26.68,26.68,0,0,1,6,1.81,23.33,23.33,0,0,1,5.32,3.19,17.84,17.84,0,0,1,4.06,4.56h.25v-33h14.25Zm-49.75-31.63a31.5,31.5,0,0,0,1.06,8.13,22.18,22.18,0,0,0,3.25,7.12,15.81,15.81,0,0,0,13.56,6.88,16,16,0,0,0,8.19-2,17,17,0,0,0,5.63-5.25,24.09,24.09,0,0,0,3.25-7.31,33.12,33.12,0,0,0,1.06-8.32q0-10.74-4.81-16.75a15.87,15.87,0,0,0-13.07-6,16.06,16.06,0,0,0-8.43,2.07A17.21,17.21,0,0,0,1718,72.7a22.21,22.21,0,0,0-3.12,7.5A38.78,38.78,0,0,0,1713.89,88.76Z" />
                    <path class="cls-1" d="M1779.51,31.14h14.25v13.5h-14.25Zm0,24.62h14.25v64.63h-14.25Z" />
                    <path class="cls-1"
                      d="M1852.89,77.39q-.89-6-4.82-9.06a15.62,15.62,0,0,0-9.93-3.07,20.65,20.65,0,0,0-5.88.94,14,14,0,0,0-5.75,3.5,19.49,19.49,0,0,0-4.37,7.13,33.82,33.82,0,0,0-1.75,11.93,35.16,35.16,0,0,0,.93,8,22.05,22.05,0,0,0,3,7.13,16.3,16.3,0,0,0,5.32,5.06,15.1,15.1,0,0,0,7.87,1.94,14.29,14.29,0,0,0,10.31-3.88q4.07-3.87,5.07-10.87h14.25q-2,12.63-9.57,19.31t-20.06,6.69a33.22,33.22,0,0,1-13.44-2.56,28.68,28.68,0,0,1-9.81-7A29.59,29.59,0,0,1,1808.2,102a41.12,41.12,0,0,1-2.06-13.25,45,45,0,0,1,2-13.62,31.05,31.05,0,0,1,6-11.06,28,28,0,0,1,9.93-7.38A33.59,33.59,0,0,1,1838,54a38.93,38.93,0,0,1,10.69,1.44,28.42,28.42,0,0,1,9,4.31,23.17,23.17,0,0,1,6.44,7.25,25.06,25.06,0,0,1,3,10.38Z" />
                    <path class="cls-1" d="M1879.14,31.14h14.25v13.5h-14.25Zm0,24.62h14.25v64.63h-14.25Z" />
                    <path class="cls-1"
                      d="M1908.89,55.76h13.5v9.5l.25.25a23.83,23.83,0,0,1,8.5-8.43A22.56,22.56,0,0,1,1942.76,54q10.62,0,16.75,5.5t6.13,16.5v44.38h-14.25V79.76q-.26-7.62-3.25-11.06t-9.38-3.44a15.41,15.41,0,0,0-6.5,1.32,14,14,0,0,0-4.87,3.62,17,17,0,0,0-3.13,5.44,19.38,19.38,0,0,0-1.12,6.62v38.13h-14.25Z" />
                    <path class="cls-1"
                      d="M1991.76,91.76a24.75,24.75,0,0,0,1.06,7.25,17.8,17.8,0,0,0,3.19,6.13,15.48,15.48,0,0,0,5.38,4.19,17.74,17.74,0,0,0,7.75,1.56q6.24,0,10.06-2.69a15.9,15.9,0,0,0,5.69-8.06h13.5a26.88,26.88,0,0,1-10.5,16.31,28.59,28.59,0,0,1-8.69,4.25,34.91,34.91,0,0,1-10.06,1.44,34.29,34.29,0,0,1-13.5-2.5,27.94,27.94,0,0,1-9.94-7,29.73,29.73,0,0,1-6.13-10.75,43.83,43.83,0,0,1-2.06-13.75,38.84,38.84,0,0,1,2.19-13.06A33.46,33.46,0,0,1,1986,64.2,29.3,29.3,0,0,1,2008.76,54a29,29,0,0,1,13.69,3.19,30.14,30.14,0,0,1,10.06,8.44,34.13,34.13,0,0,1,5.81,12.06,37,37,0,0,1,.94,14.06ZM2025,82.39a23.13,23.13,0,0,0-1.44-6.5,17.23,17.23,0,0,0-3.25-5.44,16.07,16.07,0,0,0-5-3.75,14.69,14.69,0,0,0-6.56-1.44,17,17,0,0,0-6.81,1.32,15.55,15.55,0,0,0-5.25,3.62,17.84,17.84,0,0,0-3.5,5.44,18.76,18.76,0,0,0-1.44,6.75Z" />
                    <path class="cls-1"
                      d="M438.78,164.56l19.12,44.33h.15L467,164.56h6.9l-11.33,53.55H454.9l-19-44h-.15l-9.08,44h-6.9l11.33-53.55Z" />
                    <path class="cls-1"
                      d="M479.39,185.45a14.1,14.1,0,0,1,3.79-3.94,15.83,15.83,0,0,1,5.1-2.32,23.15,23.15,0,0,1,5.92-.75,31.06,31.06,0,0,1,5.4.45,13.69,13.69,0,0,1,4.5,1.57,8.55,8.55,0,0,1,3.11,3,9.13,9.13,0,0,1,1.17,4.84,16.68,16.68,0,0,1-.42,3.56c-.27,1.27-.53,2.44-.78,3.49L504.7,206c-.15.8-.36,1.7-.64,2.7a11,11,0,0,0-.41,2.85,2.64,2.64,0,0,0,.53,1.88,1.82,1.82,0,0,0,1.35.52,3.12,3.12,0,0,0,1-.19l1-.33-1,4.72a12.34,12.34,0,0,1-1.92.56,8.91,8.91,0,0,1-2,.27,5.23,5.23,0,0,1-4-1.43,4.69,4.69,0,0,1-1.05-4l-.15-.15a13.35,13.35,0,0,1-5,4.12,18.69,18.69,0,0,1-8,1.43,17.94,17.94,0,0,1-4.62-.57,9.5,9.5,0,0,1-3.71-1.87,9.3,9.3,0,0,1-2.51-3.38,12.1,12.1,0,0,1-.94-5.06,10.71,10.71,0,0,1,1.84-6.67,11.57,11.57,0,0,1,4.69-3.64,23.14,23.14,0,0,1,6.3-1.69q3.45-.45,6.67-.75c1.7-.15,3.16-.31,4.39-.49a9.91,9.91,0,0,0,3-.86,3.81,3.81,0,0,0,1.76-1.72,7.06,7.06,0,0,0,.56-3.08,4.07,4.07,0,0,0-.75-2.55,5.39,5.39,0,0,0-1.87-1.54,8.85,8.85,0,0,0-2.52-.78,16.59,16.59,0,0,0-2.66-.23,17,17,0,0,0-3.56.38,10.28,10.28,0,0,0-3.19,1.23,8.35,8.35,0,0,0-2.4,2.18,7.13,7.13,0,0,0-1.27,3.19H477.4A13.45,13.45,0,0,1,479.39,185.45Zm1.8,26.59a8.86,8.86,0,0,0,4.84,1.35q7.58,0,10.87-5.1a12.73,12.73,0,0,0,2.14-4.73c.37-1.7.79-3.45,1.24-5.25h-.15a8.74,8.74,0,0,1-3.42,1.39c-1.37.27-2.83.49-4.38.64s-3.12.33-4.69.56A18.11,18.11,0,0,0,483.4,202a7.84,7.84,0,0,0-3.07,2.13,6,6,0,0,0-1.28,3.87A4.47,4.47,0,0,0,481.19,212Z" />
                    <path class="cls-1"
                      d="M536.65,179.34l-1.2,5.62h-7.72l-4.8,22.8c0,.45-.1.88-.15,1.28a10.18,10.18,0,0,0-.08,1.27,2.08,2.08,0,0,0,1.16,2.06,6,6,0,0,0,2.67.57,9.48,9.48,0,0,0,1.87-.19,17.19,17.19,0,0,0,1.8-.49l-1.12,5.85c-.75.1-1.5.19-2.25.26a21.2,21.2,0,0,1-2.25.12,20,20,0,0,1-3.38-.27,7.61,7.61,0,0,1-2.74-1,5.52,5.52,0,0,1-1.87-1.91,5.93,5.93,0,0,1-.71-3.08,9.92,9.92,0,0,1,.11-1.57c.07-.5.16-1.05.26-1.65l5.1-24.08h-6.52l1.2-5.62h6.52l2.4-11.48h6.38l-2.4,11.48Z" />
                    <path class="cls-1" d="M550.08,179.34,542,218.11h-6.3l8-38.77Zm-5-7,1.65-7.8h6.45l-1.65,7.8Z" />
                    <path class="cls-1"
                      d="M555.36,193.66a23.64,23.64,0,0,1,4.28-7.8,21.21,21.21,0,0,1,6.82-5.4,20,20,0,0,1,9.11-2q7.88,0,12,4.08t4.13,12a29.67,29.67,0,0,1-1.43,9.15,23.82,23.82,0,0,1-4.2,7.83,20.66,20.66,0,0,1-6.75,5.44,19.69,19.69,0,0,1-9.07,2,18.72,18.72,0,0,1-6.86-1.2A14.26,14.26,0,0,1,555,209.3a18.17,18.17,0,0,1-1.12-6.49A29.11,29.11,0,0,1,555.36,193.66Zm7.62,16.8q2.68,2.92,7.94,2.93a10.78,10.78,0,0,0,6.19-1.8,16.48,16.48,0,0,0,4.5-4.54,21.36,21.36,0,0,0,2.78-6,22,22,0,0,0,.93-6.08,15.3,15.3,0,0,0-.59-4.27,9.33,9.33,0,0,0-1.88-3.49,9.12,9.12,0,0,0-3.19-2.33,11,11,0,0,0-4.54-.86,11.59,11.59,0,0,0-6.45,1.8A16.35,16.35,0,0,0,564,190.4a20.61,20.61,0,0,0-2.81,6,23.25,23.25,0,0,0-.94,6.3A10.89,10.89,0,0,0,563,210.46Z" />
                    <path class="cls-1"
                      d="M609.62,179.34l-1.2,5.85h.15a15.14,15.14,0,0,1,6.08-5.07,18.35,18.35,0,0,1,7.72-1.68c3.65,0,6.37.8,8.14,2.4s2.66,4.12,2.66,7.57a23.49,23.49,0,0,1-.3,3.3c-.2,1.35-.47,2.78-.82,4.28l-4.73,22.12H621l4.95-22.65c.05-.4.12-.86.22-1.39s.2-1.07.3-1.65.19-1.12.27-1.65a10.28,10.28,0,0,0,.11-1.31,4.59,4.59,0,0,0-1.95-4.09,8.44,8.44,0,0,0-4.8-1.31,11.67,11.67,0,0,0-5.21,1.28,14.73,14.73,0,0,0-4.39,3.22,10.53,10.53,0,0,0-2.7,3.64,26.79,26.79,0,0,0-1.58,4.46l-4.5,21.45h-6.3l8.1-38.77Z" />
                    <path class="cls-1"
                      d="M643.34,185.45a14.06,14.06,0,0,1,3.78-3.94,15.83,15.83,0,0,1,5.1-2.32,23.22,23.22,0,0,1,5.93-.75,31.06,31.06,0,0,1,5.4.45,13.69,13.69,0,0,1,4.5,1.57,8.55,8.55,0,0,1,3.11,3,9.13,9.13,0,0,1,1.16,4.84,16.64,16.64,0,0,1-.41,3.56c-.27,1.27-.54,2.44-.79,3.49L668.65,206c-.15.8-.36,1.7-.64,2.7a11,11,0,0,0-.41,2.85,2.64,2.64,0,0,0,.52,1.88,1.82,1.82,0,0,0,1.35.52,3.18,3.18,0,0,0,1-.19l1-.33-1,4.72a12.18,12.18,0,0,1-1.91.56,9,9,0,0,1-2,.27,5.21,5.21,0,0,1-4-1.43,4.69,4.69,0,0,1-1-4l-.15-.15a13.38,13.38,0,0,1-5,4.12,18.69,18.69,0,0,1-7.95,1.43,17.86,17.86,0,0,1-4.61-.57,9.5,9.5,0,0,1-3.71-1.87,9.3,9.3,0,0,1-2.51-3.38,12.1,12.1,0,0,1-.94-5.06,10.71,10.71,0,0,1,1.84-6.67,11.53,11.53,0,0,1,4.68-3.64,23.14,23.14,0,0,1,6.3-1.69q3.45-.45,6.68-.75c1.7-.15,3.16-.31,4.39-.49a9.84,9.84,0,0,0,3-.86,3.84,3.84,0,0,0,1.77-1.72,7.06,7.06,0,0,0,.56-3.08,4.07,4.07,0,0,0-.75-2.55,5.43,5.43,0,0,0-1.88-1.54,8.78,8.78,0,0,0-2.51-.78,16.59,16.59,0,0,0-2.66-.23,17,17,0,0,0-3.56.38,10.28,10.28,0,0,0-3.19,1.23,8.35,8.35,0,0,0-2.4,2.18,7.14,7.14,0,0,0-1.28,3.19h-6.37A13.45,13.45,0,0,1,643.34,185.45Zm1.8,26.59a8.83,8.83,0,0,0,4.83,1.35q7.57,0,10.88-5.1a12.73,12.73,0,0,0,2.14-4.73q.56-2.55,1.23-5.25h-.15a8.69,8.69,0,0,1-3.41,1.39c-1.37.27-2.84.49-4.39.64s-3.11.33-4.68.56a18.11,18.11,0,0,0-4.24,1.09,7.88,7.88,0,0,0-3.08,2.13A6,6,0,0,0,643,208,4.47,4.47,0,0,0,645.14,212Z" />
                    <path class="cls-1" d="M693.55,164.56,682.3,218.11H676l11.17-53.55Z" />
                    <path class="cls-1"
                      d="M755.39,214.17q-5.89,5.15-15.79,5.14-11,0-17-6.11t-6-17.29a37.86,37.86,0,0,1,2-12.41,32.13,32.13,0,0,1,5.82-10.39,27.51,27.51,0,0,1,21.56-9.82,26.66,26.66,0,0,1,8.06,1.16,18.43,18.43,0,0,1,6.45,3.45,15.87,15.87,0,0,1,4.31,5.77,19.64,19.64,0,0,1,1.58,8.14h-7.13q0-6.3-3.71-9.41a14.34,14.34,0,0,0-9.56-3.11,19.47,19.47,0,0,0-9.79,2.36,22.07,22.07,0,0,0-6.94,6.11,26.89,26.89,0,0,0-4.16,8.51,34.16,34.16,0,0,0-1.39,9.64,24.58,24.58,0,0,0,1,7.13,15.14,15.14,0,0,0,2.92,5.51,13.23,13.23,0,0,0,4.92,3.56,17.62,17.62,0,0,0,7,1.28q6.6,0,10.72-3.49a19,19,0,0,0,5.85-9.86h7.13Q761.28,209,755.39,214.17Z" />
                    <path class="cls-1"
                      d="M775.07,204a9.33,9.33,0,0,0,.83,4,8.21,8.21,0,0,0,2.25,2.93,10.91,10.91,0,0,0,3.22,1.8,11.28,11.28,0,0,0,3.75.64,12.12,12.12,0,0,0,7-1.92A11.25,11.25,0,0,0,796.3,206h6.37a16.72,16.72,0,0,1-2.4,5.66,15.16,15.16,0,0,1-4,4,17.5,17.5,0,0,1-5.18,2.44,21.47,21.47,0,0,1-6,.83,19.1,19.1,0,0,1-8-1.47,13.82,13.82,0,0,1-5.06-3.75,13.45,13.45,0,0,1-2.62-5,20,20,0,0,1-.75-5.29,30.46,30.46,0,0,1,1.61-10.16,25.1,25.1,0,0,1,4.35-7.91,19.42,19.42,0,0,1,6.37-5.1,17,17,0,0,1,7.62-1.8q8.55,0,12.48,4.5t3.94,12.67a17.34,17.34,0,0,1-.22,2.85c-.15.9-.28,1.63-.38,2.18H775.3A24.88,24.88,0,0,0,775.07,204Zm23.36-13a9.17,9.17,0,0,0-1.5-3.53,7.9,7.9,0,0,0-2.88-2.47,9.45,9.45,0,0,0-4.43-.94,13.78,13.78,0,0,0-5,.86,12.5,12.5,0,0,0-3.86,2.37,14,14,0,0,0-2.77,3.48,20.71,20.71,0,0,0-1.8,4.24h22.5A14.2,14.2,0,0,0,798.43,191Z" />
                    <path class="cls-1"
                      d="M822.17,179.34l-1.2,5.85h.15a15.14,15.14,0,0,1,6.08-5.07,18.31,18.31,0,0,1,7.72-1.68q5.48,0,8.14,2.4t2.66,7.57a23.49,23.49,0,0,1-.3,3.3c-.2,1.35-.48,2.78-.82,4.28l-4.73,22.12H833.5l5-22.65c0-.4.12-.86.22-1.39s.2-1.07.3-1.65.19-1.12.26-1.65a8.91,8.91,0,0,0,.12-1.31,4.59,4.59,0,0,0-2-4.09,8.44,8.44,0,0,0-4.8-1.31,11.75,11.75,0,0,0-5.22,1.28,14.81,14.81,0,0,0-4.38,3.22,10.41,10.41,0,0,0-2.7,3.64,26.79,26.79,0,0,0-1.58,4.46l-4.5,21.45h-6.3l8.1-38.77Z" />
                    <path class="cls-1"
                      d="M874.22,179.34,873,185H865.3l-4.8,22.8c0,.45-.11.88-.15,1.28a10.18,10.18,0,0,0-.08,1.27,2.08,2.08,0,0,0,1.16,2.06,6,6,0,0,0,2.67.57,9.48,9.48,0,0,0,1.87-.19,17.19,17.19,0,0,0,1.8-.49l-1.12,5.85c-.75.1-1.5.19-2.25.26a21.2,21.2,0,0,1-2.25.12,20,20,0,0,1-3.38-.27,7.61,7.61,0,0,1-2.74-1,5.52,5.52,0,0,1-1.87-1.91,5.93,5.93,0,0,1-.71-3.08,9.92,9.92,0,0,1,.11-1.57c.07-.5.16-1.05.26-1.65l5.1-24.08H852.4l1.2-5.62h6.52l2.4-11.48h6.38l-2.4,11.48Z" />
                    <path class="cls-1"
                      d="M880.67,204a9.19,9.19,0,0,0,.83,4,8.21,8.21,0,0,0,2.25,2.93,10.79,10.79,0,0,0,3.22,1.8,11.28,11.28,0,0,0,3.75.64,12.12,12.12,0,0,0,7-1.92,11.17,11.17,0,0,0,4.12-5.51h6.38a16.72,16.72,0,0,1-2.4,5.66,15.2,15.2,0,0,1-4,4,17.33,17.33,0,0,1-5.17,2.44,21.47,21.47,0,0,1-6,.83,19.1,19.1,0,0,1-8-1.47,13.82,13.82,0,0,1-5.06-3.75,13.3,13.3,0,0,1-2.62-5,20,20,0,0,1-.75-5.29,30.46,30.46,0,0,1,1.61-10.16,25.1,25.1,0,0,1,4.35-7.91,19.42,19.42,0,0,1,6.37-5.1,17,17,0,0,1,7.62-1.8q8.55,0,12.48,4.5t3.94,12.67a17.34,17.34,0,0,1-.22,2.85c-.15.9-.28,1.63-.38,2.18H880.89A26.62,26.62,0,0,0,880.67,204ZM904,191a9.17,9.17,0,0,0-1.5-3.53,7.85,7.85,0,0,0-2.89-2.47,9.38,9.38,0,0,0-4.42-.94,13.78,13.78,0,0,0-5,.86,12.5,12.5,0,0,0-3.86,2.37,14,14,0,0,0-2.77,3.48,20.71,20.71,0,0,0-1.8,4.24h22.5A14.58,14.58,0,0,0,904,191Z" />
                    <path class="cls-1"
                      d="M927.54,179.34l-1.87,8.32h.15a21.18,21.18,0,0,1,5.74-6.6,13.49,13.49,0,0,1,8.36-2.62,7.87,7.87,0,0,0,1.12-.08,3,3,0,0,1,1.13.08l-1.5,6.82a4.6,4.6,0,0,0-1-.07h-.9c-.8,0-1.45,0-1.94,0a9.68,9.68,0,0,0-1.88.34,12.38,12.38,0,0,0-4.69,2.33,16.56,16.56,0,0,0-3.56,4,15.72,15.72,0,0,0-2,4.39c-.5,1.67-.9,3.24-1.2,4.69l-3.67,17.17h-6.3l8-38.77Z" />
                    <path class="cls-1"
                      d="M962,185l1.12-5.62h6.6c.5-2,1-3.85,1.39-5.7a18.7,18.7,0,0,1,1.84-4.92,9.43,9.43,0,0,1,3.34-3.45,11.43,11.43,0,0,1,6-1.31c.9,0,1.8,0,2.7.11a13.47,13.47,0,0,1,2.62.49l-1,5.4c-.55-.1-1.07-.19-1.57-.26a9,9,0,0,0-1.43-.11,6.35,6.35,0,0,0-3.6.86,5.82,5.82,0,0,0-2,2.25,11.28,11.28,0,0,0-1,3.11c-.23,1.15-.52,2.33-.87,3.53h7.43l-1,5.62h-7.5l-7.13,33.15h-6.37l7.2-33.15Z" />
                    <path class="cls-1"
                      d="M984.58,193.66a23.64,23.64,0,0,1,4.28-7.8,21.21,21.21,0,0,1,6.82-5.4,19.92,19.92,0,0,1,9.11-2q7.88,0,12,4.08t4.13,12a29.67,29.67,0,0,1-1.43,9.15,23.82,23.82,0,0,1-4.2,7.83,20.66,20.66,0,0,1-6.75,5.44,19.69,19.69,0,0,1-9.07,2,18.72,18.72,0,0,1-6.86-1.2,14.26,14.26,0,0,1-8.37-8.44,18.17,18.17,0,0,1-1.12-6.49A29.11,29.11,0,0,1,984.58,193.66Zm7.61,16.8q2.7,2.92,7.95,2.93a10.78,10.78,0,0,0,6.19-1.8,16.76,16.76,0,0,0,4.5-4.54,21.36,21.36,0,0,0,2.78-6,22,22,0,0,0,.93-6.08,14.94,14.94,0,0,0-.6-4.27,8.9,8.9,0,0,0-5.06-5.82,11,11,0,0,0-4.54-.86,11.59,11.59,0,0,0-6.45,1.8,16.35,16.35,0,0,0-4.65,4.54,20.61,20.61,0,0,0-2.81,6,23.25,23.25,0,0,0-.94,6.3A10.93,10.93,0,0,0,992.19,210.46Z" />
                    <path class="cls-1"
                      d="M1038.62,179.34l-1.88,8.32h.15a21.18,21.18,0,0,1,5.74-6.6,13.49,13.49,0,0,1,8.36-2.62,8,8,0,0,0,1.13-.08,2.9,2.9,0,0,1,1.12.08l-1.5,6.82a4.49,4.49,0,0,0-1-.07h-.9q-1.2,0-1.95,0a9.82,9.82,0,0,0-1.88.34,12.38,12.38,0,0,0-4.69,2.33,16.56,16.56,0,0,0-3.56,4,15.71,15.71,0,0,0-2,4.39c-.5,1.67-.9,3.24-1.2,4.69l-3.68,17.17h-6.3l8-38.77Z" />
                    <path class="cls-1"
                      d="M1103.94,164.56q7.88,0,11.4,3.38t3.53,9.45a14.08,14.08,0,0,1-2.74,8.28,12.49,12.49,0,0,1-3.19,3,10.55,10.55,0,0,1-4.27,1.62v.15a10.83,10.83,0,0,1,5.85,3.93,11.59,11.59,0,0,1,2.17,7.17,15.94,15.94,0,0,1-1.46,6.9,15.23,15.23,0,0,1-4,5.21,19.06,19.06,0,0,1-6,3.3,23.21,23.21,0,0,1-7.42,1.16h-26.48l11.18-53.55Zm-7.35,47.55a31.91,31.91,0,0,0,3.53-.26,12.71,12.71,0,0,0,4.27-1.35,10.58,10.58,0,0,0,3.64-3.19,9.62,9.62,0,0,0,1.54-5.77,8.29,8.29,0,0,0-.9-4.13,6.12,6.12,0,0,0-2.44-2.4,10.84,10.84,0,0,0-3.53-1.12,27.79,27.79,0,0,0-4.16-.3h-15.3l-3.9,18.52Zm3.75-24.52q11.4,0,11.4-10.2a6.17,6.17,0,0,0-1-3.75,6.31,6.31,0,0,0-2.59-2,11.47,11.47,0,0,0-3.41-.86,33.17,33.17,0,0,0-3.49-.19H1088l-3.6,17Z" />
                    <path class="cls-1" d="M1136.19,179.34l-8.1,38.77h-6.3l8-38.77Zm-5-7,1.65-7.8h6.45l-1.65,7.8Z" />
                    <path class="cls-1"
                      d="M1141.48,193.66a23.62,23.62,0,0,1,4.27-7.8,21.24,21.24,0,0,1,6.83-5.4,19.92,19.92,0,0,1,9.11-2q7.88,0,12,4.08t4.12,12a29.66,29.66,0,0,1-1.42,9.15,23.82,23.82,0,0,1-4.2,7.83,20.66,20.66,0,0,1-6.75,5.44,19.74,19.74,0,0,1-9.08,2,18.76,18.76,0,0,1-6.86-1.2,14.21,14.21,0,0,1-8.36-8.44,18.17,18.17,0,0,1-1.12-6.49A28.83,28.83,0,0,1,1141.48,193.66Zm7.61,16.8q2.7,2.92,8,2.93a10.8,10.8,0,0,0,6.19-1.8,16.76,16.76,0,0,0,4.5-4.54,21.33,21.33,0,0,0,2.77-6,21.66,21.66,0,0,0,.94-6.08,14.94,14.94,0,0,0-.6-4.27,9,9,0,0,0-5.06-5.82,11.08,11.08,0,0,0-4.54-.86,11.59,11.59,0,0,0-6.45,1.8,16.35,16.35,0,0,0-4.65,4.54,20.36,20.36,0,0,0-2.81,6,22.87,22.87,0,0,0-.94,6.3A10.93,10.93,0,0,0,1149.09,210.46Z" />
                    <path class="cls-1"
                      d="M1206.09,179.34l-1.2,5.62h-7.73l-4.8,22.8c0,.45-.1.88-.15,1.28a10.24,10.24,0,0,0-.07,1.27,2.07,2.07,0,0,0,1.16,2.06,6,6,0,0,0,2.66.57,9.59,9.59,0,0,0,1.88-.19,17.19,17.19,0,0,0,1.8-.49l-1.13,5.85c-.75.1-1.5.19-2.25.26a21.2,21.2,0,0,1-2.25.12,19.92,19.92,0,0,1-3.37-.27,7.61,7.61,0,0,1-2.74-1,5.52,5.52,0,0,1-1.87-1.91,5.93,5.93,0,0,1-.72-3.08,9.9,9.9,0,0,1,.12-1.57c.07-.5.16-1.05.26-1.65l5.1-24.08h-6.53l1.2-5.62H1192l2.4-11.48h6.37l-2.4,11.48Z" />
                    <path class="cls-1"
                      d="M1212.54,204a9.33,9.33,0,0,0,.82,4,8.21,8.21,0,0,0,2.25,2.93,11,11,0,0,0,3.23,1.8,11.28,11.28,0,0,0,3.75.64,12.12,12.12,0,0,0,7.05-1.92,11.23,11.23,0,0,0,4.12-5.51h6.38a16.72,16.72,0,0,1-2.4,5.66,15.2,15.2,0,0,1-4,4,17.44,17.44,0,0,1-5.17,2.44,21.47,21.47,0,0,1-6,.83,19.1,19.1,0,0,1-8-1.47,13.73,13.73,0,0,1-5.06-3.75,13.47,13.47,0,0,1-2.63-5,20,20,0,0,1-.75-5.29,30.71,30.71,0,0,1,1.61-10.16,25.31,25.31,0,0,1,4.36-7.91,19.32,19.32,0,0,1,6.37-5.1,16.93,16.93,0,0,1,7.61-1.8q8.55,0,12.49,4.5t3.94,12.67a17.32,17.32,0,0,1-.23,2.85c-.15.9-.27,1.63-.37,2.18h-29.18A24.88,24.88,0,0,0,1212.54,204Zm23.36-13a9.48,9.48,0,0,0-1.5-3.53,8,8,0,0,0-2.89-2.47,9.41,9.41,0,0,0-4.42-.94,13.74,13.74,0,0,0-5,.86,12.38,12.38,0,0,0-3.86,2.37,14.06,14.06,0,0,0-2.78,3.48,20.71,20.71,0,0,0-1.8,4.24h22.5A14.57,14.57,0,0,0,1235.9,191Z" />
                    <path class="cls-1"
                      d="M1274.71,186.05a8.54,8.54,0,0,0-6-2,12.6,12.6,0,0,0-6.49,1.65,15.46,15.46,0,0,0-4.72,4.28,19.2,19.2,0,0,0-2.89,5.88,22.39,22.39,0,0,0-1,6.42,18.44,18.44,0,0,0,.48,4.27,9.62,9.62,0,0,0,1.62,3.53,8,8,0,0,0,3,2.4,10.26,10.26,0,0,0,4.54.9,11.49,11.49,0,0,0,7-2.18,12.45,12.45,0,0,0,4.27-5.77h6.38a17.68,17.68,0,0,1-6.3,10.05,18.39,18.39,0,0,1-11.4,3.45q-8,0-12-4.35t-4-12.3a28.61,28.61,0,0,1,1.39-8.93,23.07,23.07,0,0,1,4.12-7.61,19.9,19.9,0,0,1,15.94-7.31q6.6,0,10.46,3.18t4.09,10h-6.37A7.19,7.19,0,0,0,1274.71,186.05Z" />
                    <path class="cls-1"
                      d="M1303.29,164.56,1298.71,185l.15.15a15.14,15.14,0,0,1,6.08-5.07,18.35,18.35,0,0,1,7.72-1.68q5.47,0,8.14,2.4t2.66,7.57a23.49,23.49,0,0,1-.3,3.3c-.2,1.35-.47,2.78-.82,4.28l-4.73,22.12h-6.37l5-22.65c0-.4.12-.86.22-1.39s.2-1.07.3-1.65.19-1.12.26-1.65a8.91,8.91,0,0,0,.12-1.31,4.59,4.59,0,0,0-1.95-4.09,8.44,8.44,0,0,0-4.8-1.31,11.75,11.75,0,0,0-5.22,1.28,14.81,14.81,0,0,0-4.38,3.22,10.53,10.53,0,0,0-2.7,3.64,26.79,26.79,0,0,0-1.58,4.46l-4.5,21.45h-6.3l11.25-53.55Z" />
                    <path class="cls-1"
                      d="M1341.61,179.34l-1.2,5.85h.15a15.14,15.14,0,0,1,6.08-5.07,18.35,18.35,0,0,1,7.72-1.68q5.48,0,8.14,2.4t2.66,7.57a23.49,23.49,0,0,1-.3,3.3c-.2,1.35-.47,2.78-.82,4.28l-4.73,22.12h-6.37l5-22.65c0-.4.12-.86.22-1.39s.2-1.07.3-1.65.19-1.12.26-1.65a8.91,8.91,0,0,0,.12-1.31,4.59,4.59,0,0,0-2-4.09,8.44,8.44,0,0,0-4.8-1.31,11.75,11.75,0,0,0-5.22,1.28,14.81,14.81,0,0,0-4.38,3.22,10.53,10.53,0,0,0-2.7,3.64,26.79,26.79,0,0,0-1.58,4.46l-4.5,21.45h-6.3l8.1-38.77Z" />
                    <path class="cls-1"
                      d="M1372.1,193.66a23.62,23.62,0,0,1,4.27-7.8,21.24,21.24,0,0,1,6.83-5.4,19.92,19.92,0,0,1,9.11-2q7.88,0,12,4.08t4.13,12a29.67,29.67,0,0,1-1.43,9.15,23.82,23.82,0,0,1-4.2,7.83,20.66,20.66,0,0,1-6.75,5.44,19.69,19.69,0,0,1-9.07,2,18.82,18.82,0,0,1-6.87-1.2,14.28,14.28,0,0,1-8.36-8.44,18.17,18.17,0,0,1-1.12-6.49A28.83,28.83,0,0,1,1372.1,193.66Zm7.61,16.8q2.7,2.92,8,2.93a10.8,10.8,0,0,0,6.19-1.8,16.76,16.76,0,0,0,4.5-4.54,21.33,21.33,0,0,0,2.77-6,21.66,21.66,0,0,0,.94-6.08,14.94,14.94,0,0,0-.6-4.27,8.9,8.9,0,0,0-5.06-5.82,11.08,11.08,0,0,0-4.54-.86,11.59,11.59,0,0,0-6.45,1.8,16.35,16.35,0,0,0-4.65,4.54,20.36,20.36,0,0,0-2.81,6,22.87,22.87,0,0,0-.94,6.3A10.93,10.93,0,0,0,1379.71,210.46Z" />
                    <path class="cls-1" d="M1429.66,164.56l-11.25,53.55h-6.3l11.18-53.55Z" />
                    <path class="cls-1"
                      d="M1431.8,193.66a23.62,23.62,0,0,1,4.27-7.8,21.24,21.24,0,0,1,6.83-5.4,19.92,19.92,0,0,1,9.11-2q7.88,0,12,4.08t4.12,12a29.66,29.66,0,0,1-1.42,9.15,23.82,23.82,0,0,1-4.2,7.83,20.66,20.66,0,0,1-6.75,5.44,19.74,19.74,0,0,1-9.08,2,18.76,18.76,0,0,1-6.86-1.2,14.21,14.21,0,0,1-8.36-8.44,18.17,18.17,0,0,1-1.13-6.49A28.83,28.83,0,0,1,1431.8,193.66Zm7.61,16.8q2.7,2.92,7.95,2.93a10.8,10.8,0,0,0,6.19-1.8,16.76,16.76,0,0,0,4.5-4.54,21.33,21.33,0,0,0,2.77-6,21.66,21.66,0,0,0,.94-6.08,14.94,14.94,0,0,0-.6-4.27,9,9,0,0,0-5.06-5.82,11.08,11.08,0,0,0-4.54-.86,11.59,11.59,0,0,0-6.45,1.8,16.35,16.35,0,0,0-4.65,4.54,20.36,20.36,0,0,0-2.81,6,22.87,22.87,0,0,0-.94,6.3A10.93,10.93,0,0,0,1439.41,210.46Z" />
                    <path class="cls-1"
                      d="M1505.11,218.22a42.28,42.28,0,0,1-1.58,4.77,16.38,16.38,0,0,1-6.9,8.32,21.65,21.65,0,0,1-10.72,2.48,23.88,23.88,0,0,1-5.74-.68,14.84,14.84,0,0,1-4.84-2.1,11.05,11.05,0,0,1-3.41-3.71,11.55,11.55,0,0,1-1.39-5.51h6.3a6.24,6.24,0,0,0,1,3.18,6.06,6.06,0,0,0,2.17,1.95,9.21,9.21,0,0,0,3,1,24,24,0,0,0,3.52.26,12.06,12.06,0,0,0,6-1.35,11.56,11.56,0,0,0,3.86-3.52,18.41,18.41,0,0,0,2.37-5c.57-1.88,1.11-3.76,1.61-5.66l-.15-.15a11.91,11.91,0,0,1-5.25,4.5,17.17,17.17,0,0,1-6.83,1.35,16,16,0,0,1-6.34-1.17,11.82,11.82,0,0,1-4.53-3.3,14.61,14.61,0,0,1-2.74-5.06,20.9,20.9,0,0,1-.94-6.45,27.41,27.41,0,0,1,1.39-8.55,25.65,25.65,0,0,1,4-7.69,20.83,20.83,0,0,1,6.33-5.55,16.87,16.87,0,0,1,8.48-2.13,15,15,0,0,1,4.16.56,15.29,15.29,0,0,1,3.68,1.57,10.67,10.67,0,0,1,2.85,2.48,8.52,8.52,0,0,1,1.61,3.26v.15h.15l1.2-7.12h6l-7,33.15Q1505.86,215.49,1505.11,218.22Zm-24.45-11.88a9.87,9.87,0,0,0,1.76,3.3,8.36,8.36,0,0,0,3,2.28,9.55,9.55,0,0,0,4.2.87,11,11,0,0,0,6.27-1.8,15.09,15.09,0,0,0,4.38-4.58,22.14,22.14,0,0,0,2.59-6,24.36,24.36,0,0,0,.86-6.18,10.75,10.75,0,0,0-2.43-7.35q-2.45-2.78-7.47-2.78a9.72,9.72,0,0,0-5.92,1.88,16.68,16.68,0,0,0-4.28,4.61,22.49,22.49,0,0,0-2.62,5.92,21.83,21.83,0,0,0-.9,5.89A13,13,0,0,0,1480.66,206.34Z" />
                    <path class="cls-1"
                      d="M1525,228.2a16.49,16.49,0,0,1-2.62,2.92,10.93,10.93,0,0,1-3.23,1.95,11.26,11.26,0,0,1-4.2.72,10.54,10.54,0,0,1-2.32-.27,8.76,8.76,0,0,1-2.1-.71l1.12-5.17a7.5,7.5,0,0,0,1.8.75,7.15,7.15,0,0,0,1.8.3,5.2,5.2,0,0,0,3.53-1.17,12.37,12.37,0,0,0,2.47-3l3.9-6.38-6.82-38.77h6.82l4.5,30.82h.15l16.28-30.82h7l-25.65,45.3C1526.58,225.89,1525.78,227.07,1525,228.2Z" />
                    <path class="cls-1" d="M1591,164.56l-11.25,53.55h-7.12l11.25-53.55Z" />
                    <path class="cls-1"
                      d="M1605.45,179.34l-1.2,5.85h.15a15.14,15.14,0,0,1,6.08-5.07,18.35,18.35,0,0,1,7.72-1.68c3.65,0,6.37.8,8.14,2.4s2.66,4.12,2.66,7.57a23.49,23.49,0,0,1-.3,3.3c-.2,1.35-.47,2.78-.82,4.28l-4.73,22.12h-6.37l5-22.65c0-.4.12-.86.22-1.39s.2-1.07.3-1.65.19-1.12.27-1.65a10.28,10.28,0,0,0,.11-1.31,4.59,4.59,0,0,0-2-4.09,8.44,8.44,0,0,0-4.8-1.31,11.67,11.67,0,0,0-5.21,1.28,14.73,14.73,0,0,0-4.39,3.22,10.53,10.53,0,0,0-2.7,3.64,26.79,26.79,0,0,0-1.58,4.46l-4.5,21.45h-6.3l8.1-38.77Z" />
                    <path class="cls-1"
                      d="M1635.53,185l1.12-5.62h6.6c.5-2,1-3.85,1.39-5.7a18.7,18.7,0,0,1,1.84-4.92,9.43,9.43,0,0,1,3.34-3.45,11.43,11.43,0,0,1,6-1.31c.9,0,1.8,0,2.7.11a13.47,13.47,0,0,1,2.62.49l-1,5.4c-.55-.1-1.07-.19-1.57-.26a9,9,0,0,0-1.43-.11,6.35,6.35,0,0,0-3.6.86,5.82,5.82,0,0,0-2,2.25,11.28,11.28,0,0,0-1,3.11c-.23,1.15-.52,2.33-.87,3.53H1657l-1,5.62h-7.5l-7.13,33.15h-6.37l7.2-33.15Z" />
                    <path class="cls-1"
                      d="M1658.14,193.66a23.64,23.64,0,0,1,4.28-7.8,21.21,21.21,0,0,1,6.82-5.4,20,20,0,0,1,9.11-2q7.88,0,12,4.08t4.13,12a29.67,29.67,0,0,1-1.43,9.15,23.82,23.82,0,0,1-4.2,7.83,20.66,20.66,0,0,1-6.75,5.44,19.69,19.69,0,0,1-9.07,2,18.72,18.72,0,0,1-6.86-1.2,14.26,14.26,0,0,1-8.37-8.44,18.17,18.17,0,0,1-1.12-6.49A29.11,29.11,0,0,1,1658.14,193.66Zm7.61,16.8q2.7,2.92,8,2.93a10.78,10.78,0,0,0,6.19-1.8,16.48,16.48,0,0,0,4.5-4.54,21.36,21.36,0,0,0,2.78-6,22,22,0,0,0,.93-6.08,14.94,14.94,0,0,0-.6-4.27,8.9,8.9,0,0,0-5.06-5.82,11,11,0,0,0-4.54-.86,11.59,11.59,0,0,0-6.45,1.8,16.35,16.35,0,0,0-4.65,4.54,20.61,20.61,0,0,0-2.81,6,23.25,23.25,0,0,0-.94,6.3A10.93,10.93,0,0,0,1665.75,210.46Z" />
                    <path class="cls-1"
                      d="M1712.18,179.34l-1.88,8.32h.15a21.18,21.18,0,0,1,5.74-6.6,13.51,13.51,0,0,1,8.36-2.62,8,8,0,0,0,1.13-.08,2.9,2.9,0,0,1,1.12.08l-1.5,6.82a4.49,4.49,0,0,0-1-.07h-.9q-1.2,0-2,0a9.82,9.82,0,0,0-1.88.34,12.27,12.27,0,0,0-4.68,2.33,16.39,16.39,0,0,0-3.57,4,15.71,15.71,0,0,0-2,4.39c-.5,1.67-.9,3.24-1.2,4.69l-3.68,17.17h-6.3l8-38.77Z" />
                    <path class="cls-1"
                      d="M1737.23,179.34l-1.43,5.77.15.15a18.56,18.56,0,0,1,6-5,16,16,0,0,1,7.54-1.83,12,12,0,0,1,6.3,1.57,7.83,7.83,0,0,1,3.45,5.4,16.69,16.69,0,0,1,5.82-5.06,15.48,15.48,0,0,1,7.46-1.91,16.53,16.53,0,0,1,4,.48,11.55,11.55,0,0,1,3.49,1.5,7.46,7.46,0,0,1,2.44,2.67,8.36,8.36,0,0,1,.9,4,23.25,23.25,0,0,1-.38,3.9c-.25,1.45-.5,2.72-.75,3.82l-4.87,23.25h-6.38l5.4-24.6a21.64,21.64,0,0,0,.41-2.14,13.51,13.51,0,0,0,.19-2.06,4.8,4.8,0,0,0-1.69-3.75,6.11,6.11,0,0,0-4.23-1.5,8.83,8.83,0,0,0-2.74.45,15,15,0,0,0-2.66,1.16,15,15,0,0,0-4.35,3.72,11,11,0,0,0-2.33,4,43.53,43.53,0,0,0-1.27,4.73l-4.28,20H1747l4.65-22.12c.35-1.5.64-2.9.86-4.2a20.19,20.19,0,0,0,.34-2.63,5,5,0,0,0-1.39-3.75,5.53,5.53,0,0,0-4-1.35,10.34,10.34,0,0,0-5.22,1.5,17.3,17.3,0,0,0-4.31,3.45,10.93,10.93,0,0,0-2.77,3.94,33.21,33.21,0,0,0-1.35,4.84l-4.35,20.32h-6.3l8.17-38.77Z" />
                    <path class="cls-1"
                      d="M1793.29,185.45a14.1,14.1,0,0,1,3.79-3.94,15.83,15.83,0,0,1,5.1-2.32,23.15,23.15,0,0,1,5.92-.75,31.06,31.06,0,0,1,5.4.45,13.69,13.69,0,0,1,4.5,1.57,8.55,8.55,0,0,1,3.11,3,9.13,9.13,0,0,1,1.17,4.84,16.68,16.68,0,0,1-.42,3.56c-.27,1.27-.53,2.44-.78,3.49L1818.6,206c-.15.8-.36,1.7-.64,2.7a11,11,0,0,0-.41,2.85,2.64,2.64,0,0,0,.53,1.88,1.82,1.82,0,0,0,1.35.52,3.12,3.12,0,0,0,1-.19l1-.33-1,4.72a12.34,12.34,0,0,1-1.92.56,8.91,8.91,0,0,1-2,.27,5.23,5.23,0,0,1-4-1.43,4.69,4.69,0,0,1-1-4l-.15-.15a13.35,13.35,0,0,1-5,4.12,18.69,18.69,0,0,1-8,1.43,17.94,17.94,0,0,1-4.62-.57,9.5,9.5,0,0,1-3.71-1.87,9.3,9.3,0,0,1-2.51-3.38,12.1,12.1,0,0,1-.94-5.06,10.71,10.71,0,0,1,1.84-6.67,11.57,11.57,0,0,1,4.69-3.64,23.14,23.14,0,0,1,6.3-1.69q3.45-.45,6.67-.75c1.7-.15,3.16-.31,4.39-.49a9.91,9.91,0,0,0,3-.86,3.81,3.81,0,0,0,1.76-1.72,7.06,7.06,0,0,0,.56-3.08,4.07,4.07,0,0,0-.75-2.55,5.39,5.39,0,0,0-1.87-1.54,8.85,8.85,0,0,0-2.52-.78,16.59,16.59,0,0,0-2.66-.23,17,17,0,0,0-3.56.38,10.28,10.28,0,0,0-3.19,1.23,8.35,8.35,0,0,0-2.4,2.18,7.13,7.13,0,0,0-1.27,3.19h-6.38A13.45,13.45,0,0,1,1793.29,185.45Zm1.8,26.59a8.86,8.86,0,0,0,4.84,1.35q7.58,0,10.87-5.1a12.73,12.73,0,0,0,2.14-4.73c.37-1.7.79-3.45,1.24-5.25H1814a8.74,8.74,0,0,1-3.42,1.39c-1.37.27-2.83.49-4.38.64s-3.12.33-4.69.56a18.11,18.11,0,0,0-4.24,1.09,7.84,7.84,0,0,0-3.07,2.13A6,6,0,0,0,1793,208,4.47,4.47,0,0,0,1795.09,212Z" />
                    <path class="cls-1"
                      d="M1850.55,179.34l-1.2,5.62h-7.72l-4.8,22.8c0,.45-.1.88-.15,1.28a10.18,10.18,0,0,0-.08,1.27,2.08,2.08,0,0,0,1.16,2.06,6,6,0,0,0,2.67.57,9.48,9.48,0,0,0,1.87-.19,17.19,17.19,0,0,0,1.8-.49l-1.12,5.85c-.75.1-1.5.19-2.25.26a21.2,21.2,0,0,1-2.25.12,20,20,0,0,1-3.38-.27,7.61,7.61,0,0,1-2.74-1,5.52,5.52,0,0,1-1.87-1.91,5.93,5.93,0,0,1-.71-3.08,9.92,9.92,0,0,1,.11-1.57c.07-.5.16-1.05.26-1.65l5.1-24.08h-6.52l1.2-5.62h6.52l2.4-11.48h6.38l-2.4,11.48Z" />
                    <path class="cls-1" d="M1864,179.34l-8.1,38.77h-6.3l8-38.77Zm-5-7,1.65-7.8h6.45l-1.65,7.8Z" />
                    <path class="cls-1"
                      d="M1869.26,193.66a23.64,23.64,0,0,1,4.28-7.8,21.21,21.21,0,0,1,6.82-5.4,20,20,0,0,1,9.11-2q7.88,0,12,4.08t4.13,12a29.67,29.67,0,0,1-1.43,9.15,23.82,23.82,0,0,1-4.2,7.83,20.66,20.66,0,0,1-6.75,5.44,19.69,19.69,0,0,1-9.07,2,18.72,18.72,0,0,1-6.86-1.2,14.26,14.26,0,0,1-8.37-8.44,18.17,18.17,0,0,1-1.12-6.49A29.11,29.11,0,0,1,1869.26,193.66Zm7.61,16.8q2.7,2.92,8,2.93a10.78,10.78,0,0,0,6.19-1.8,16.48,16.48,0,0,0,4.5-4.54,21.36,21.36,0,0,0,2.78-6,22,22,0,0,0,.93-6.08,14.94,14.94,0,0,0-.6-4.27,8.9,8.9,0,0,0-5.06-5.82,11,11,0,0,0-4.54-.86,11.59,11.59,0,0,0-6.45,1.8,16.35,16.35,0,0,0-4.65,4.54,20.61,20.61,0,0,0-2.81,6,23.25,23.25,0,0,0-.94,6.3A10.93,10.93,0,0,0,1876.87,210.46Z" />
                    <path class="cls-1"
                      d="M1923.52,179.34l-1.2,5.85h.15a15.14,15.14,0,0,1,6.08-5.07,18.35,18.35,0,0,1,7.72-1.68c3.65,0,6.37.8,8.14,2.4s2.66,4.12,2.66,7.57a23.49,23.49,0,0,1-.3,3.3c-.2,1.35-.47,2.78-.82,4.28l-4.73,22.12h-6.37l5-22.65c0-.4.12-.86.22-1.39s.2-1.07.3-1.65.19-1.12.27-1.65a10.28,10.28,0,0,0,.11-1.31,4.59,4.59,0,0,0-2-4.09,8.44,8.44,0,0,0-4.8-1.31,11.75,11.75,0,0,0-5.22,1.28,14.81,14.81,0,0,0-4.38,3.22,10.53,10.53,0,0,0-2.7,3.64,26.79,26.79,0,0,0-1.58,4.46l-4.5,21.45h-6.3l8.1-38.77Z" />
                  </g>
                </g>
              </svg>
            </a>
        </div>
        </div>
    </div>
</header>

<main id="main_content">
  <div class="grid-container">
    <h1 aria-label="400 Error">400</h1>
    <h2>bad request</h2>
    <p class="margin-bottom-3 mobile:margin-bottom-6">Sorry, something went wrong. Please try again later.</p>
    <p>Try one of these options instead:</p>
    <div class="margin-bottom-3 mobile:margin-bottom-6">
      <ul class="usa-list usa-list--unstyled flex-wrapper display-block tablet:display-flex">
        <li class="flex-child"><button class="usa-button" id="ncbiHomeBtn">NCBI Home</button></li>
        <li class="flex-child"><button class="usa-button" id="helpDeskBtn">Contact Help Desk</button></li>
        <li class="flex-child flex-fill">
          <form class="usa-search" role="search" method="get" action="https://www.ncbi.nlm.nih.gov/search/all">
            <input class="usa-input" id="basic-search-field-medium" type="search" name="term" placeholder="Search NCBI" aria-label="Search NCBI">
            <button class="usa-button usa-button__reset" type="reset"></button>
            <button class="usa-button usa-button__search" type="submit" aria-label="Search" data-section="link_click" data-ga-action="search_ncbi" data-ga-label="NONE">
              <span aria-hidden="true">Search</span>
            </button>
          </form>
        </li>
      </ul>
    </div>
  </div>
</main>

<footer>
  <section class="icon-section">
    <div id="icon-section-header" class="icon-section_header">Follow NCBI</div>
    <div class="grid-container container">
      <div class="icon-section_container">
        <a class="footer-icon" id="footer_twitter" href="https://twitter.com/ncbi" aria-label="Twitter"><svg
            data-name="Layer 1" xmlns="http://www.w3.org/2000/svg" viewBox="0 0 300 300">
            <defs>
              <style>
                .cls-11 {
                  fill: #737373;
                }
              </style>
            </defs>
            <title>Twitter</title>
            <path class="cls-11"
              d="M250.11,105.48c-7,3.14-13,3.25-19.27.14,8.12-4.86,8.49-8.27,11.43-17.46a78.8,78.8,0,0,1-25,9.55,39.35,39.35,0,0,0-67,35.85,111.6,111.6,0,0,1-81-41.08A39.37,39.37,0,0,0,81.47,145a39.08,39.08,0,0,1-17.8-4.92c0,.17,0,.33,0,.5a39.32,39.32,0,0,0,31.53,38.54,39.26,39.26,0,0,1-17.75.68,39.37,39.37,0,0,0,36.72,27.3A79.07,79.07,0,0,1,56,223.34,111.31,111.31,0,0,0,116.22,241c72.3,0,111.83-59.9,111.83-111.84,0-1.71,0-3.4-.1-5.09C235.62,118.54,244.84,113.37,250.11,105.48Z">
            </path>
          </svg></a>
        <a class="footer-icon" id="footer_facebook" href="https://www.facebook.com/ncbi.nlm" aria-label="Facebook"><svg
            data-name="Layer 1" xmlns="http://www.w3.org/2000/svg" viewBox="0 0 300 300">
            <title>Facebook</title>
            <path class="cls-11"
              d="M210.5,115.12H171.74V97.82c0-8.14,5.39-10,9.19-10h27.14V52l-39.32-.12c-35.66,0-42.42,26.68-42.42,43.77v19.48H99.09v36.32h27.24v109h45.41v-109h35Z">
            </path>
          </svg></a>
        <a class="footer-icon" id="footer_linkedin"
          href="https://www.linkedin.com/company/ncbinlm"
          aria-label="LinkedIn"><svg data-name="Layer 1" xmlns="http://www.w3.org/2000/svg" viewBox="0 0 300 300">
            <title>LinkedIn</title>
            <path class="cls-11"
              d="M101.64,243.37H57.79v-114h43.85Zm-22-131.54h-.26c-13.25,0-21.82-10.36-21.82-21.76,0-11.65,8.84-21.15,22.33-21.15S101.7,78.72,102,90.38C102,101.77,93.4,111.83,79.63,111.83Zm100.93,52.61A17.54,17.54,0,0,0,163,182v61.39H119.18s.51-105.23,0-114H163v13a54.33,54.33,0,0,1,34.54-12.66c26,0,44.39,18.8,44.39,55.29v58.35H198.1V182A17.54,17.54,0,0,0,180.56,164.44Z">
            </path>
          </svg></a>
        <a class="footer-icon" id="footer_github" href="https://github.com/ncbi" aria-label="GitHub"><svg
            data-name="Layer 1" xmlns="http://www.w3.org/2000/svg" viewBox="0 0 300 300">
            <defs>
              <style>
                .cls-11,
                .cls-12 {
                  fill: #737373;
                }

                .cls-11 {
                  fill-rule: evenodd;
                }
              </style>
            </defs>
            <title>GitHub</title>
            <path class="cls-11"
              d="M151.36,47.28a105.76,105.76,0,0,0-33.43,206.1c5.28,1,7.22-2.3,7.22-5.09,0-2.52-.09-10.85-.14-19.69-29.42,6.4-35.63-12.48-35.63-12.48-4.81-12.22-11.74-15.47-11.74-15.47-9.59-6.56.73-6.43.73-6.43,10.61.75,16.21,10.9,16.21,10.9,9.43,16.17,24.73,11.49,30.77,8.79,1-6.83,3.69-11.5,6.71-14.14C108.57,197.1,83.88,188,83.88,147.51a40.92,40.92,0,0,1,10.9-28.39c-1.1-2.66-4.72-13.42,1-28,0,0,8.88-2.84,29.09,10.84a100.26,100.26,0,0,1,53,0C198,88.3,206.9,91.14,206.9,91.14c5.76,14.56,2.14,25.32,1,28a40.87,40.87,0,0,1,10.89,28.39c0,40.62-24.74,49.56-48.29,52.18,3.79,3.28,7.17,9.71,7.17,19.58,0,14.15-.12,25.54-.12,29,0,2.82,1.9,6.11,7.26,5.07A105.76,105.76,0,0,0,151.36,47.28Z">
            </path>
            <path class="cls-12"
              d="M85.66,199.12c-.23.52-1.06.68-1.81.32s-1.2-1.06-.95-1.59,1.06-.69,1.82-.33,1.21,1.07.94,1.6Zm-1.3-1">
            </path>
            <path class="cls-12"
              d="M90,203.89c-.51.47-1.49.25-2.16-.49a1.61,1.61,0,0,1-.31-2.19c.52-.47,1.47-.25,2.17.49s.82,1.72.3,2.19Zm-1-1.08">
            </path>
            <path class="cls-12"
              d="M94.12,210c-.65.46-1.71,0-2.37-.91s-.64-2.07,0-2.52,1.7,0,2.36.89.65,2.08,0,2.54Zm0,0"></path>
            <path class="cls-12"
              d="M99.83,215.87c-.58.64-1.82.47-2.72-.41s-1.18-2.06-.6-2.7,1.83-.46,2.74.41,1.2,2.07.58,2.7Zm0,0">
            </path>
            <path class="cls-12"
              d="M107.71,219.29c-.26.82-1.45,1.2-2.64.85s-2-1.34-1.74-2.17,1.44-1.23,2.65-.85,2,1.32,1.73,2.17Zm0,0">
            </path>
            <path class="cls-12"
              d="M116.36,219.92c0,.87-1,1.59-2.24,1.61s-2.29-.68-2.3-1.54,1-1.59,2.26-1.61,2.28.67,2.28,1.54Zm0,0">
            </path>
            <path class="cls-12"
              d="M124.42,218.55c.15.85-.73,1.72-2,1.95s-2.37-.3-2.52-1.14.73-1.75,2-2,2.37.29,2.53,1.16Zm0,0"></path>
          </svg></a>
        <a class="footer-icon" id="footer_blog" href="https://ncbiinsights.ncbi.nlm.nih.gov/" aria-label="Blog">
          <svg id="Layer_1" data-name="Layer 1" xmlns="http://www.w3.org/2000/svg" viewBox="0 0 40 40"><defs><style>.cls-13{fill:#737373;}</style></defs><path class="cls-13" d="M14,30a4,4,0,1,1-4-4,4,4,0,0,1,4,4Zm11,3A19,19,0,0,0,7.05,15a1,1,0,0,0-1,1v3a1,1,0,0,0,.93,1A14,14,0,0,1,20,33.07,1,1,0,0,0,21,34h3a1,1,0,0,0,1-1Zm9,0A28,28,0,0,0,7,6,1,1,0,0,0,6,7v3a1,1,0,0,0,1,1A23,23,0,0,1,29,33a1,1,0,0,0,1,1h3A1,1,0,0,0,34,33Z"/></svg>
        </a>
      </div>
    </div>
  </section>

  <section class="container-fluid bg-primary">
    <div class="container pt-5">
      <div class="row mt-3">
        <div class="col-lg-3 col-12">
          <p><a class="text-white" href="https://www.nlm.nih.gov/socialmedia/index.html">Connect with NLM</a></p>
          <ul class="list-inline social_media">
            <li class="list-inline-item"><a href="https://twitter.com/NLM_NIH" aria-label="Twitter"
                target="_blank" rel="noopener noreferrer"><svg version="1.1" xmlns="http://www.w3.org/2000/svg"
                  xmlns:xlink="http://www.w3.org/1999/xlink" x="0px" y="0px" viewBox="0 0 249 249"
                  style="enable-background:new 0 0 249 249;" xml:space="preserve">
                  <style type="text/css">
                    .st20 {
                      fill: #FFFFFF;
                    }

                    .st30 {
                      fill: none;
                      stroke: #FFFFFF;
                      stroke-width: 8;
                      stroke-miterlimit: 10;
                    }
                  </style>
                  <title>SM-Twitter</title>
                  <g>
                    <g>
                      <g>
                        <path class="st20" d="M192.9,88.1c-5,2.2-9.2,2.3-13.6,0.1c5.7-3.4,6-5.8,8.1-12.3c-5.4,3.2-11.4,5.5-17.6,6.7
                                            c-10.5-11.2-28.1-11.7-39.2-1.2c-7.2,6.8-10.2,16.9-8,26.5c-22.3-1.1-43.1-11.7-57.2-29C58,91.6,61.8,107.9,74,116
                                            c-4.4-0.1-8.7-1.3-12.6-3.4c0,0.1,0,0.2,0,0.4c0,13.2,9.3,24.6,22.3,27.2c-4.1,1.1-8.4,1.3-12.5,0.5c3.6,11.3,14,19,25.9,19.3
                                            c-11.6,9.1-26.4,13.2-41.1,11.5c12.7,8.1,27.4,12.5,42.5,12.5c51,0,78.9-42.2,78.9-78.9c0-1.2,0-2.4-0.1-3.6
                                            C182.7,97.4,189.2,93.7,192.9,88.1z"></path>
                      </g>
                    </g>
                    <circle class="st30" cx="124.4" cy="128.8" r="108.2"></circle>
                  </g>
                </svg></a></li>
            <li class="list-inline-item"><a href="https://www.facebook.com/nationallibraryofmedicine"
                aria-label="Facebook" rel="noopener noreferrer" target="_blank">
                <svg version="1.1" xmlns="http://www.w3.org/2000/svg" xmlns:xlink="http://www.w3.org/1999/xlink" x="0px"
                  y="0px" viewBox="0 0 249 249" style="enable-background:new 0 0 249 249;" xml:space="preserve">
                  <style type="text/css">
                    .st10 {
                      fill: #FFFFFF;
                    }

                    .st110 {
                      fill: none;
                      stroke: #FFFFFF;
                      stroke-width: 8;
                      stroke-miterlimit: 10;
                    }
                  </style>
                  <title>SM-Facebook</title>
                  <g>
                    <g>
                      <path class="st10" d="M159,99.1h-24V88.4c0-5,3.3-6.2,5.7-6.2h16.8V60l-24.4-0.1c-22.1,0-26.2,16.5-26.2,27.1v12.1H90v22.5h16.9
                                                  v67.5H135v-67.5h21.7L159,99.1z"></path>
                    </g>
                  </g>
                  <circle class="st110" cx="123.6" cy="123.2" r="108.2"></circle>
                </svg>
              </a></li>
            <li class="list-inline-item"><a href="https://www.youtube.com/user/NLMNIH" aria-label="Youtube"
                target="_blank" rel="noopener noreferrer"><svg version="1.1" xmlns="http://www.w3.org/2000/svg"
                  xmlns:xlink="http://www.w3.org/1999/xlink" x="0px" y="0px" viewBox="0 0 249 249"
                  style="enable-background:new 0 0 249 249;" xml:space="preserve">
                  <title>SM-Youtube</title>
                  <style type="text/css">
                    .st4 {
                      fill: none;
                      stroke: #FFFFFF;
                      stroke-width: 8;
                      stroke-miterlimit: 10;
                    }

                    .st5 {
                      fill: #FFFFFF;
                    }
                  </style>
                  <circle class="st4" cx="124.2" cy="123.4" r="108.2"></circle>
                  <g transform="translate(0,-952.36218)">
                    <path class="st5"
                      d="M88.4,1037.4c-10.4,0-18.7,8.3-18.7,18.7v40.1c0,10.4,8.3,18.7,18.7,18.7h72.1c10.4,0,18.7-8.3,18.7-18.7
                                        v-40.1c0-10.4-8.3-18.7-18.7-18.7H88.4z M115.2,1058.8l29.4,17.4l-29.4,17.4V1058.8z"></path>
                  </g>
                </svg></a></li>
          </ul>
        </div>
        <div class="col-lg-3 col-12">
          <p class="address_footer text-white">National Library of Medicine<br>
            <a href="https://www.google.com/maps/place/8600+Rockville+Pike,+Bethesda,+MD+20894/@38.9959508,-77.101021,17z/data=!3m1!4b1!4m5!3m4!1s0x89b7c95e25765ddb:0x19156f88b27635b8!8m2!3d38.9959508!4d-77.0988323"
              class="text-white" target="_blank" rel="noopener noreferrer">8600 Rockville Pike<br>
              Bethesda, MD 20894</a></p>
        </div>
        <div class="col-lg-3 col-12 centered-lg">
          <p><a href="https://www.nlm.nih.gov/web_policies.html" class="text-white">Web Policies</a><br>
            <a href="https://www.nih.gov/institutes-nih/nih-office-director/office-communications-public-liaison/freedom-information-act-office"
              class="text-white">FOIA</a><br>
            <a href="https://www.hhs.gov/vulnerability-disclosure-policy/index.html" class="text-white" id="vdp">HHS Vulnerability Disclosure</a></p>
        </div>
        <div class="col-lg-3 col-12 centered-lg">
          <p><a class="supportLink text-white" href="https://support.nlm.nih.gov/">Help</a><br>
            <a href="https://www.nlm.nih.gov/accessibility.html" class="text-white">Accessibility</a><br>
            <a href="https://www.nlm.nih.gov/careers/careers.html" class="text-white">Careers</a></p>
        </div>
      </div>
      <div class="row">
        <div class="col-lg-12 centered-lg">
          <nav class="bottom-links">
            <ul class="mt-3">
              <li>
                <a class="text-white" href="//www.nlm.nih.gov/">NLM</a>
              </li>
              <li>
                <a class="text-white"
              href="https://www.nih.gov/">NIH</a>
              </li>
              <li>
                <a class="text-white" href="https://www.hhs.gov/">HHS</a>
              </li>
              <li>
                <a
              class="text-white" href="https://www.usa.gov/">USA.gov</a>
              </li>
            </ul>
          </nav>
        </div>
      </div>
    </div>
  </section>
</footer>

</body>
<script>
  const userEvents =  ['click', 'keypress'];
  for (let i = 0; i < userEvents.length; i++) {
    let evt = userEvents[i];
    document.querySelector('#icon-section-header').addEventListener(evt, function(e){
      if (document.body.clientWidth < 993) {
        classToggle(e.target);
      }
    });
  }
  function classToggle(elm) {
    elm.classList.toggle('opened');
  }
  let helpDeskBtn = document.querySelector('#helpDeskBtn');
  if (!!helpDeskBtn) {
    let helpDeskLink = 'https://support.nlm.nih.gov/support/create-case?from=' + encodeURIComponent(window.location.href);
    helpDeskBtn.addEventListener('click',  function(){
      window.open(helpDeskLink, '_blank')
    });
  }
  let ncbiHomeBtn = document.querySelector('#ncbiHomeBtn');
  if (!!ncbiHomeBtn) {
    ncbiHomeBtn.addEventListener('click', function(){
      window.open('https://www.ncbi.nlm.nih.gov', '_blank')
    });
  }
  // Following JavaScript is to toggle top banner of page.
  var head_bnr = document.querySelector(".usa-banner header.usa-banner-header");
  var btn_bnr = document.querySelector(".usa-banner button.usa-accordion-button.usa-banner-button");
  var acr_bnr = document.querySelector(".usa-banner div.usa-banner-content.usa-accordion-content");
  btn_bnr.addEventListener("click", function(e) {
    head_bnr.classList.toggle("usa-banner-header-expanded");
    var aria_val = this.getAttribute("aria-expanded");
    var opp_aria_val = (aria_val === "false") ? "true" : "false";
    this.setAttribute("aria-expanded", opp_aria_val);
    acr_bnr.setAttribute("aria-hidden", aria_val);
    e.stopPropagation();
  });
</script>
</html>

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.