Viewing data for Mustelus manazo


Scientific name Mustelus manazo
Common name Starspotted smooth-hound
Maximum lifespan 10.00 years (Mustelus manazo@AnAge)

Total mtDNA (size: 16707 bases) GC AT G C A T
Base content (bases) 6396 10311 4077 2319 5172 5139
Base content per 1 kb (bases) 383 617 244 139 310 308
Base content (%) 38.3% 61.7%
Total protein-coding genes (size: 11412 bases) GC AT G C A T
Base content (bases) 4377 7035 2967 1410 3650 3385
Base content per 1 kb (bases) 384 616 260 124 320 297
Base content (%) 38.4% 61.6%
D-loop (size: 1068 bases) GC AT G C A T
Base content (bases) 360 708 210 150 368 340
Base content per 1 kb (bases) 337 663 197 140 345 318
Base content (%) 33.7% 66.3%
Total tRNA-coding genes (size: 1552 bases) GC AT G C A T
Base content (bases) 620 932 337 283 440 492
Base content per 1 kb (bases) 399 601 217 182 284 317
Base content (%) 39.9% 60.1%
Total rRNA-coding genes (size: 2623 bases) GC AT G C A T
Base content (bases) 1018 1605 550 468 695 910
Base content per 1 kb (bases) 388 612 210 178 265 347
Base content (%) 38.8% 61.2%
12S rRNA gene (size: 953 bases) GC AT G C A T
Base content (bases) 398 555 214 184 241 314
Base content per 1 kb (bases) 418 582 225 193 253 329
Base content (%) 41.8% 58.2%
16S rRNA gene (size: 1670 bases) GC AT G C A T
Base content (bases) 620 1050 336 284 454 596
Base content per 1 kb (bases) 371 629 201 170 272 357
Base content (%) 37.1% 62.9%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 244 440 171 73 237 203
Base content per 1 kb (bases) 357 643 250 107 346 297
Base content (%) 35.7% 64.3%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 47 121 33 14 59 62
Base content per 1 kb (bases) 280 720 196 83 351 369
Base content (%) 28.0% 72.0%
COX1 (size: 1557 bases) GC AT G C A T
Base content (bases) 604 953 358 246 526 427
Base content per 1 kb (bases) 388 612 230 158 338 274
Base content (%) 38.8% 61.2%
COX2 (size: 691 bases) GC AT G C A T
Base content (bases) 263 428 163 100 205 223
Base content per 1 kb (bases) 381 619 236 145 297 323
Base content (%) 38.1% 61.9%
COX3 (size: 786 bases) GC AT G C A T
Base content (bases) 329 457 205 124 239 218
Base content per 1 kb (bases) 419 581 261 158 304 277
Base content (%) 41.9% 58.1%
CYTB (size: 1146 bases) GC AT G C A T
Base content (bases) 461 685 310 151 384 301
Base content per 1 kb (bases) 402 598 271 132 335 263
Base content (%) 40.2% 59.8%
ND1 (size: 975 bases) GC AT G C A T
Base content (bases) 388 587 271 117 303 284
Base content per 1 kb (bases) 398 602 278 120 311 291
Base content (%) 39.8% 60.2%
ND2 (size: 1047 bases) GC AT G C A T
Base content (bases) 394 653 290 104 332 321
Base content per 1 kb (bases) 376 624 277 99 317 307
Base content (%) 37.6% 62.4%
ND3 (size: 351 bases) GC AT G C A T
Base content (bases) 150 201 96 54 119 82
Base content per 1 kb (bases) 427 573 274 154 339 234
Base content (%) 42.7% 57.3%
ND4 (size: 1381 bases) GC AT G C A T
Base content (bases) 519 862 360 159 453 409
Base content per 1 kb (bases) 376 624 261 115 328 296
Base content (%) 37.6% 62.4%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 125 172 89 36 97 75
Base content per 1 kb (bases) 421 579 300 121 327 253
Base content (%) 42.1% 57.9%
ND5 (size: 1830 bases) GC AT G C A T
Base content (bases) 659 1171 471 188 602 569
Base content per 1 kb (bases) 360 640 257 103 329 311
Base content (%) 36.0% 64.0%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 198 324 152 46 102 222
Base content per 1 kb (bases) 379 621 291 88 195 425
Base content (%) 37.9% 62.1%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.96%)
Alanine (Ala, A)
n = 18 (7.93%)
Serine (Ser, S)
n = 9 (3.96%)
Threonine (Thr, T)
n = 22 (9.69%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 10 (4.41%)
Leucine (Leu, L)
n = 53 (23.35%)
Isoleucine (Ile, I)
n = 24 (10.57%)
Methionine (Met, M)
n = 11 (4.85%)
Proline (Pro, P)
n = 16 (7.05%)
Phenylalanine (Phe, F)
n = 14 (6.17%)
Tyrosine (Tyr, Y)
n = 4 (1.76%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.32%)
Asparagine (Asn, N)
n = 9 (3.96%)
Glutamine (Gln, Q)
n = 9 (3.96%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 2 (0.88%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 5 9 12 4 16 0 20 7 2 2 2 6 0 11 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 2 10 6 0 3 2 4 0 6 3 7 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 6 2 1 0 3 0 2 3 4 0 1 1 6 3 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 3 0 0 1 2 0 1 0 4 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
41 65 73 49
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
24 60 32 112
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 46 98 76
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPNPWFLILLFSWIVFLTILPNKVMSHLFNNDPTLKSTEKPKPNPWNWPWL*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 3 (5.45%)
Threonine (Thr, T)
n = 3 (5.45%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 2 (3.64%)
Leucine (Leu, L)
n = 9 (16.36%)
Isoleucine (Ile, I)
n = 3 (5.45%)
Methionine (Met, M)
n = 2 (3.64%)
Proline (Pro, P)
n = 9 (16.36%)
Phenylalanine (Phe, F)
n = 4 (7.27%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 1 (1.82%)
Glutamic acid (Glu, E)
n = 1 (1.82%)
Asparagine (Asn, N)
n = 7 (12.73%)
Glutamine (Gln, Q)
n = 1 (1.82%)
Histidine (His, H)
n = 1 (1.82%)
Lysine (Lys, K)
n = 4 (7.27%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 0 1 1 0 2 0 5 1 0 1 0 1 0 3 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 0 0 0 0 0 0 4 1 3 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 0 0 0 1 0 2 0 0 0 0 1 3 4 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 0 1 0 4 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
4 14 21 17
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
7 13 16 20
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 6 25 22
COX1 (size: 1557 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 45 (8.69%)
Alanine (Ala, A)
n = 44 (8.49%)
Serine (Ser, S)
n = 32 (6.18%)
Threonine (Thr, T)
n = 33 (6.37%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 39 (7.53%)
Leucine (Leu, L)
n = 64 (12.36%)
Isoleucine (Ile, I)
n = 43 (8.3%)
Methionine (Met, M)
n = 25 (4.83%)
Proline (Pro, P)
n = 31 (5.98%)
Phenylalanine (Phe, F)
n = 40 (7.72%)
Tyrosine (Tyr, Y)
n = 18 (3.47%)
Tryptophan (Trp, W)
n = 17 (3.28%)
Aspartic acid (Asp, D)
n = 15 (2.9%)
Glutamic acid (Glu, E)
n = 10 (1.93%)
Asparagine (Asn, N)
n = 15 (2.9%)
Glutamine (Gln, Q)
n = 11 (2.12%)
Histidine (His, H)
n = 19 (3.67%)
Lysine (Lys, K)
n = 8 (1.54%)
Arginine (Arg, R)
n = 8 (1.54%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
31 12 21 20 8 13 3 20 9 2 18 1 16 4 25 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 10 12 20 2 14 12 16 3 9 5 17 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 15 0 9 6 13 0 0 4 13 5 0 0 10 5 10
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 10 0 11 4 8 0 2 0 6 0 0 0 1 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
153 113 128 125
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
75 136 97 211
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 109 202 190
COX2 (size: 691 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.93%)
Alanine (Ala, A)
n = 17 (7.42%)
Serine (Ser, S)
n = 16 (6.99%)
Threonine (Thr, T)
n = 12 (5.24%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 16 (6.99%)
Leucine (Leu, L)
n = 25 (10.92%)
Isoleucine (Ile, I)
n = 23 (10.04%)
Methionine (Met, M)
n = 13 (5.68%)
Proline (Pro, P)
n = 13 (5.68%)
Phenylalanine (Phe, F)
n = 8 (3.49%)
Tyrosine (Tyr, Y)
n = 10 (4.37%)
Tryptophan (Trp, W)
n = 5 (2.18%)
Aspartic acid (Asp, D)
n = 12 (5.24%)
Glutamic acid (Glu, E)
n = 16 (6.99%)
Asparagine (Asn, N)
n = 4 (1.75%)
Glutamine (Gln, Q)
n = 9 (3.93%)
Histidine (His, H)
n = 10 (4.37%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 6 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 6 11 3 5 8 0 9 9 0 6 1 9 0 4 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 0 5 7 5 0 3 3 3 0 6 3 3 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 6 0 2 1 10 0 0 3 6 4 0 0 3 1 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 15 1 6 6 3 1 3 0 3 0 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 54 59 47
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 55 65 85
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 54 99 72
COX3 (size: 786 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (8.05%)
Alanine (Ala, A)
n = 22 (8.43%)
Serine (Ser, S)
n = 13 (4.98%)
Threonine (Thr, T)
n = 22 (8.43%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 18 (6.9%)
Leucine (Leu, L)
n = 34 (13.03%)
Isoleucine (Ile, I)
n = 12 (4.6%)
Methionine (Met, M)
n = 8 (3.07%)
Proline (Pro, P)
n = 13 (4.98%)
Phenylalanine (Phe, F)
n = 22 (8.43%)
Tyrosine (Tyr, Y)
n = 13 (4.98%)
Tryptophan (Trp, W)
n = 12 (4.6%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 10 (3.83%)
Asparagine (Asn, N)
n = 3 (1.15%)
Glutamine (Gln, Q)
n = 8 (3.07%)
Histidine (His, H)
n = 16 (6.13%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 4 6 13 6 6 0 9 8 0 7 2 7 2 11 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 1 5 7 10 0 4 5 12 0 4 2 7 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 12 0 1 3 5 1 0 3 7 6 0 0 1 2 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 10 0 2 3 2 0 2 0 3 0 0 0 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
76 67 50 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 67 58 94
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 71 110 76
CYTB (size: 1146 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 23 (6.04%)
Alanine (Ala, A)
n = 27 (7.09%)
Serine (Ser, S)
n = 26 (6.82%)
Threonine (Thr, T)
n = 14 (3.67%)
Cysteine (Cys, C)
n = 4 (1.05%)
Valine (Val, V)
n = 19 (4.99%)
Leucine (Leu, L)
n = 63 (16.54%)
Isoleucine (Ile, I)
n = 41 (10.76%)
Methionine (Met, M)
n = 12 (3.15%)
Proline (Pro, P)
n = 20 (5.25%)
Phenylalanine (Phe, F)
n = 34 (8.92%)
Tyrosine (Tyr, Y)
n = 13 (3.41%)
Tryptophan (Trp, W)
n = 12 (3.15%)
Aspartic acid (Asp, D)
n = 9 (2.36%)
Glutamic acid (Glu, E)
n = 6 (1.57%)
Asparagine (Asn, N)
n = 21 (5.51%)
Glutamine (Gln, Q)
n = 8 (2.1%)
Histidine (His, H)
n = 12 (3.15%)
Lysine (Lys, K)
n = 9 (2.36%)
Arginine (Arg, R)
n = 8 (2.1%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
27 14 8 18 11 17 3 14 8 0 5 6 8 0 13 21
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 3 6 15 5 1 2 6 11 4 5 5 10 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 5 0 6 8 8 1 1 2 5 8 1 0 12 9 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 5 1 3 6 9 0 1 3 3 1 0 0 0 1 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
84 97 100 101
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
50 84 79 169
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 129 122 114
ND1 (size: 975 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.56%)
Alanine (Ala, A)
n = 27 (8.33%)
Serine (Ser, S)
n = 19 (5.86%)
Threonine (Thr, T)
n = 25 (7.72%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 11 (3.4%)
Leucine (Leu, L)
n = 64 (19.75%)
Isoleucine (Ile, I)
n = 29 (8.95%)
Methionine (Met, M)
n = 13 (4.01%)
Proline (Pro, P)
n = 24 (7.41%)
Phenylalanine (Phe, F)
n = 21 (6.48%)
Tyrosine (Tyr, Y)
n = 13 (4.01%)
Tryptophan (Trp, W)
n = 8 (2.47%)
Aspartic acid (Asp, D)
n = 3 (0.93%)
Glutamic acid (Glu, E)
n = 10 (3.09%)
Asparagine (Asn, N)
n = 13 (4.01%)
Glutamine (Gln, Q)
n = 7 (2.16%)
Histidine (His, H)
n = 4 (1.23%)
Lysine (Lys, K)
n = 7 (2.16%)
Arginine (Arg, R)
n = 8 (2.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 9 12 12 12 18 1 20 5 2 2 3 5 1 14 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 6 10 11 0 1 9 6 2 5 6 13 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 10 0 0 6 10 0 2 1 8 5 0 1 5 8 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 9 1 2 1 6 1 2 3 2 1 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 86 90 80
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 92 58 138
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 93 136 85
ND2 (size: 1047 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (4.89%)
Alanine (Ala, A)
n = 25 (7.18%)
Serine (Ser, S)
n = 28 (8.05%)
Threonine (Thr, T)
n = 43 (12.36%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 6 (1.72%)
Leucine (Leu, L)
n = 80 (22.99%)
Isoleucine (Ile, I)
n = 33 (9.48%)
Methionine (Met, M)
n = 11 (3.16%)
Proline (Pro, P)
n = 20 (5.75%)
Phenylalanine (Phe, F)
n = 14 (4.02%)
Tyrosine (Tyr, Y)
n = 7 (2.01%)
Tryptophan (Trp, W)
n = 10 (2.87%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 6 (1.72%)
Asparagine (Asn, N)
n = 17 (4.89%)
Glutamine (Gln, Q)
n = 9 (2.59%)
Histidine (His, H)
n = 6 (1.72%)
Lysine (Lys, K)
n = 9 (2.59%)
Arginine (Arg, R)
n = 5 (1.44%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 10 9 22 11 23 0 23 8 1 1 1 3 1 9 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 0 8 10 7 0 4 3 9 1 7 6 7 0 12
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 19 0 4 4 13 2 2 3 5 2 2 1 7 10 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 6 0 0 1 9 0 0 2 3 0 0 0 0 1 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
55 96 118 80
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 111 56 144
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 83 147 108
ND3 (size: 1047 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (4.89%)
Alanine (Ala, A)
n = 25 (7.18%)
Serine (Ser, S)
n = 28 (8.05%)
Threonine (Thr, T)
n = 43 (12.36%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 6 (1.72%)
Leucine (Leu, L)
n = 80 (22.99%)
Isoleucine (Ile, I)
n = 33 (9.48%)
Methionine (Met, M)
n = 11 (3.16%)
Proline (Pro, P)
n = 20 (5.75%)
Phenylalanine (Phe, F)
n = 14 (4.02%)
Tyrosine (Tyr, Y)
n = 7 (2.01%)
Tryptophan (Trp, W)
n = 10 (2.87%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 6 (1.72%)
Asparagine (Asn, N)
n = 17 (4.89%)
Glutamine (Gln, Q)
n = 9 (2.59%)
Histidine (His, H)
n = 6 (1.72%)
Lysine (Lys, K)
n = 9 (2.59%)
Arginine (Arg, R)
n = 5 (1.44%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 10 9 22 11 23 0 23 8 1 1 1 3 1 9 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 0 8 10 7 0 4 3 9 1 7 6 7 0 12
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 19 0 4 4 13 2 2 3 5 2 2 1 7 10 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 6 0 0 1 9 0 0 2 3 0 0 0 0 1 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
55 96 118 80
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 111 56 144
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 83 147 108
ND4 (size: 1381 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (4.36%)
Alanine (Ala, A)
n = 35 (7.63%)
Serine (Ser, S)
n = 36 (7.84%)
Threonine (Thr, T)
n = 35 (7.63%)
Cysteine (Cys, C)
n = 4 (0.87%)
Valine (Val, V)
n = 11 (2.4%)
Leucine (Leu, L)
n = 85 (18.52%)
Isoleucine (Ile, I)
n = 48 (10.46%)
Methionine (Met, M)
n = 25 (5.45%)
Proline (Pro, P)
n = 23 (5.01%)
Phenylalanine (Phe, F)
n = 24 (5.23%)
Tyrosine (Tyr, Y)
n = 14 (3.05%)
Tryptophan (Trp, W)
n = 20 (4.36%)
Aspartic acid (Asp, D)
n = 5 (1.09%)
Glutamic acid (Glu, E)
n = 10 (2.18%)
Asparagine (Asn, N)
n = 18 (3.92%)
Glutamine (Gln, Q)
n = 12 (2.61%)
Histidine (His, H)
n = 13 (2.83%)
Lysine (Lys, K)
n = 11 (2.4%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
34 14 21 25 14 14 0 32 11 1 4 2 4 1 13 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 4 8 16 11 0 4 4 11 1 5 5 12 1 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 14 1 10 11 5 1 1 8 6 8 1 0 5 13 8
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 9 1 2 3 9 2 2 1 8 0 0 0 0 0 19
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
81 112 146 121
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
64 120 83 193
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 128 180 138
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 5 (5.1%)
Alanine (Ala, A)
n = 11 (11.22%)
Serine (Ser, S)
n = 15 (15.31%)
Threonine (Thr, T)
n = 5 (5.1%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 1 (1.02%)
Leucine (Leu, L)
n = 18 (18.37%)
Isoleucine (Ile, I)
n = 7 (7.14%)
Methionine (Met, M)
n = 9 (9.18%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 6 (6.12%)
Tyrosine (Tyr, Y)
n = 1 (1.02%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 5 (5.1%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 3 8 7 2 6 0 2 2 0 0 1 0 0 5 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 2 1 2 5 4 0 3 1 1 0 1 1 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 1 0 3 5 4 0 0 3 1 0 0 1 0 5 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 0 0 1 0 0 0 2 0 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
20 23 29 27
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
14 30 14 41
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 36 32 29
ND5 (size: 1830 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (4.6%)
Alanine (Ala, A)
n = 37 (6.08%)
Serine (Ser, S)
n = 52 (8.54%)
Threonine (Thr, T)
n = 50 (8.21%)
Cysteine (Cys, C)
n = 5 (0.82%)
Valine (Val, V)
n = 20 (3.28%)
Leucine (Leu, L)
n = 110 (18.06%)
Isoleucine (Ile, I)
n = 62 (10.18%)
Methionine (Met, M)
n = 22 (3.61%)
Proline (Pro, P)
n = 27 (4.43%)
Phenylalanine (Phe, F)
n = 39 (6.4%)
Tyrosine (Tyr, Y)
n = 14 (2.3%)
Tryptophan (Trp, W)
n = 14 (2.3%)
Aspartic acid (Asp, D)
n = 13 (2.13%)
Glutamic acid (Glu, E)
n = 11 (1.81%)
Asparagine (Asn, N)
n = 35 (5.75%)
Glutamine (Gln, Q)
n = 19 (3.12%)
Histidine (His, H)
n = 17 (2.79%)
Lysine (Lys, K)
n = 25 (4.11%)
Arginine (Arg, R)
n = 9 (1.48%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
42 20 20 35 11 29 3 32 19 0 10 3 6 1 22 17
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 4 8 18 11 0 10 9 9 0 13 1 13 0 12
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 20 0 10 12 17 1 4 8 4 10 0 0 15 20 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 10 1 10 3 23 2 2 2 4 1 0 0 1 0 14
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
109 150 206 145
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
68 154 135 253
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 167 228 204
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (15.61%)
Alanine (Ala, A)
n = 11 (6.36%)
Serine (Ser, S)
n = 10 (5.78%)
Threonine (Thr, T)
n = 6 (3.47%)
Cysteine (Cys, C)
n = 1 (0.58%)
Valine (Val, V)
n = 20 (11.56%)
Leucine (Leu, L)
n = 34 (19.65%)
Isoleucine (Ile, I)
n = 4 (2.31%)
Methionine (Met, M)
n = 12 (6.94%)
Proline (Pro, P)
n = 4 (2.31%)
Phenylalanine (Phe, F)
n = 9 (5.2%)
Tyrosine (Tyr, Y)
n = 10 (5.78%)
Tryptophan (Trp, W)
n = 7 (4.05%)
Aspartic acid (Asp, D)
n = 4 (2.31%)
Glutamic acid (Glu, E)
n = 5 (2.89%)
Asparagine (Asn, N)
n = 2 (1.16%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 2 (1.16%)
Lysine (Lys, K)
n = 2 (1.16%)
Arginine (Arg, R)
n = 3 (1.73%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 0 7 3 0 0 0 21 0 0 11 0 6 3 9 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 0 7 0 3 1 11 1 4 11 2 0 1 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 2 5 3 1 0 1 0 10 0 4 10 2 0 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 3 4 0 1 1 0 0 0 3 0 1 0 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 12 28 67
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
40 30 25 79
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
45 4 49 76
Total protein-coding genes (size: 11435 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 228 (5.98%)
Alanine (Ala, A)
n = 285 (7.48%)
Serine (Ser, S)
n = 266 (6.98%)
Threonine (Thr, T)
n = 275 (7.22%)
Cysteine (Cys, C)
n = 24 (0.63%)
Valine (Val, V)
n = 176 (4.62%)
Leucine (Leu, L)
n = 671 (17.61%)
Isoleucine (Ile, I)
n = 337 (8.85%)
Methionine (Met, M)
n = 165 (4.33%)
Proline (Pro, P)
n = 210 (5.51%)
Phenylalanine (Phe, F)
n = 242 (6.35%)
Tyrosine (Tyr, Y)
n = 120 (3.15%)
Tryptophan (Trp, W)
n = 121 (3.18%)
Aspartic acid (Asp, D)
n = 73 (1.92%)
Glutamic acid (Glu, E)
n = 96 (2.52%)
Asparagine (Asn, N)
n = 153 (4.02%)
Glutamine (Gln, Q)
n = 97 (2.55%)
Histidine (His, H)
n = 105 (2.76%)
Lysine (Lys, K)
n = 84 (2.2%)
Arginine (Arg, R)
n = 72 (1.89%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
237 100 133 177 93 159 12 215 89 8 68 23 72 13 143 99
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
32 10 14 69 114 97 5 60 57 89 22 70 40 96 4 74
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
86 109 6 52 62 91 7 16 38 72 48 9 15 72 81 47
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
58 87 9 44 29 77 7 15 14 36 7 0 1 7 3 112
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
858 925 1069 959
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
500 982 738 1591
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
160 956 1469 1226

Error: F​a​i​l​e​d​ t​o​ u​n​d​e​r​s​t​a​n​d​ i​d​:​ ?​t​e​r​m​=​(​"​M​u​s​t​e​l​u​s​
F​a​i​l​e​d​ t​o​ u​n​d​e​r​s​t​a​n​d​ i​d​:​ m​a​n​a​z​o​"​[​O​r​g​a​n​i​s​m​]​)​
F​a​i​l​e​d​ t​o​ u​n​d​e​r​s​t​a​n​d​ i​d​:​ A​N​D​
F​a​i​l​e​d​ t​o​ u​n​d​e​r​s​t​a​n​d​ i​d​:​ (​r​e​f​s​e​q​[​f​i​l​t​e​r​]​
F​a​i​l​e​d​ t​o​ u​n​d​e​r​s​t​a​n​d​ i​d​:​ A​N​D​
F​a​i​l​e​d​ t​o​ u​n​d​e​r​s​t​a​n​d​ i​d​:​ m​i​t​o​c​h​o​n​d​r​i​o​n​[​f​i​l​t​e​r​]​)​



Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.