Viewing data for Panthera leo


Scientific name Panthera leo
Common name Lion
Maximum lifespan 27.00 years (Panthera leo@AnAge)

Total mtDNA (size: 16818 bases) GC AT G C A T
Base content (bases) 6879 9939 4443 2436 4569 5370
Base content per 1 kb (bases) 409 591 264 145 272 319
Base content (%) 40.9% 59.1%
Total protein-coding genes (size: 11339 bases) GC AT G C A T
Base content (bases) 4687 6652 3179 1508 3170 3482
Base content per 1 kb (bases) 413 587 280 133 280 307
Base content (%) 41.3% 58.7%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1514 bases) GC AT G C A T
Base content (bases) 560 954 317 243 428 526
Base content per 1 kb (bases) 370 630 209 161 283 347
Base content (%) 37.0% 63.0%
Total rRNA-coding genes (size: 2540 bases) GC AT G C A T
Base content (bases) 1033 1507 569 464 587 920
Base content per 1 kb (bases) 407 593 224 183 231 362
Base content (%) 40.7% 59.3%
12S rRNA gene (size: 964 bases) GC AT G C A T
Base content (bases) 403 561 231 172 216 345
Base content per 1 kb (bases) 418 582 240 178 224 358
Base content (%) 41.8% 58.2%
16S rRNA gene (size: 1576 bases) GC AT G C A T
Base content (bases) 630 946 338 292 371 575
Base content per 1 kb (bases) 400 600 214 185 235 365
Base content (%) 40.0% 60.0%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 285 396 199 86 198 198
Base content per 1 kb (bases) 419 581 292 126 291 291
Base content (%) 41.9% 58.1%
ATP8 (size: 204 bases) GC AT G C A T
Base content (bases) 64 140 50 14 57 83
Base content per 1 kb (bases) 314 686 245 69 279 407
Base content (%) 31.4% 68.6%
COX1 (size: 1554 bases) GC AT G C A T
Base content (bases) 639 915 356 283 503 412
Base content per 1 kb (bases) 411 589 229 182 324 265
Base content (%) 41.1% 58.9%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 280 404 172 108 193 211
Base content per 1 kb (bases) 409 591 251 158 282 308
Base content (%) 40.9% 59.1%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 343 441 218 125 230 211
Base content per 1 kb (bases) 438 563 278 159 293 269
Base content (%) 43.8% 56.3%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 497 643 337 160 324 319
Base content per 1 kb (bases) 436 564 296 140 284 280
Base content (%) 43.6% 56.4%
ND1 (size: 956 bases) GC AT G C A T
Base content (bases) 415 541 299 116 252 289
Base content per 1 kb (bases) 434 566 313 121 264 302
Base content (%) 43.4% 56.6%
ND2 (size: 1042 bases) GC AT G C A T
Base content (bases) 407 635 311 96 254 381
Base content per 1 kb (bases) 391 609 298 92 244 366
Base content (%) 39.1% 60.9%
ND3 (size: 347 bases) GC AT G C A T
Base content (bases) 140 207 99 41 98 109
Base content per 1 kb (bases) 403 597 285 118 282 314
Base content (%) 40.3% 59.7%
ND4 (size: 1369 bases) GC AT G C A T
Base content (bases) 574 795 406 168 363 432
Base content per 1 kb (bases) 419 581 297 123 265 316
Base content (%) 41.9% 58.1%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 115 182 74 41 93 89
Base content per 1 kb (bases) 387 613 249 138 313 300
Base content (%) 38.7% 61.3%
ND5 (size: 1821 bases) GC AT G C A T
Base content (bases) 741 1080 523 218 512 568
Base content per 1 kb (bases) 407 593 287 120 281 312
Base content (%) 40.7% 59.3%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 211 317 153 58 111 206
Base content per 1 kb (bases) 400 600 290 110 210 390
Base content (%) 40.0% 60.0%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.87%)
Alanine (Ala, A)
n = 17 (7.52%)
Serine (Ser, S)
n = 13 (5.75%)
Threonine (Thr, T)
n = 23 (10.18%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 15 (6.64%)
Leucine (Leu, L)
n = 43 (19.03%)
Isoleucine (Ile, I)
n = 22 (9.73%)
Methionine (Met, M)
n = 11 (4.87%)
Proline (Pro, P)
n = 13 (5.75%)
Phenylalanine (Phe, F)
n = 12 (5.31%)
Tyrosine (Tyr, Y)
n = 2 (0.88%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 12 (5.31%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 8 (3.54%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 4 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 7 7 5 4 13 9 11 9 0 1 6 6 2 7 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 7 8 0 2 2 1 8 0 3 6 4 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 7 0 4 1 5 0 0 3 0 2 0 1 5 7 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 3 0 0 1 4 0 0 2 2 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
47 65 75 40
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
21 63 40 103
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 71 83 55
ATP8 (size: 204 bases)
Amino acid sequence: MPQLDTSTWFITIISMIMTLFIMFQLKISKHLYPSSPEPKSTAALKQPNPWEKKWTKIYSPLSLPQQ*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 2 (2.99%)
Serine (Ser, S)
n = 8 (11.94%)
Threonine (Thr, T)
n = 6 (8.96%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 7 (10.45%)
Isoleucine (Ile, I)
n = 7 (10.45%)
Methionine (Met, M)
n = 4 (5.97%)
Proline (Pro, P)
n = 8 (11.94%)
Phenylalanine (Phe, F)
n = 3 (4.48%)
Tyrosine (Tyr, Y)
n = 2 (2.99%)
Tryptophan (Trp, W)
n = 3 (4.48%)
Aspartic acid (Asp, D)
n = 1 (1.49%)
Glutamic acid (Glu, E)
n = 2 (2.99%)
Asparagine (Asn, N)
n = 1 (1.49%)
Glutamine (Gln, Q)
n = 5 (7.46%)
Histidine (His, H)
n = 1 (1.49%)
Lysine (Lys, K)
n = 7 (10.45%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 2 3 1 0 3 0 3 4 1 0 0 0 0 2 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 1 0 1 0 0 0 0 0 4 1 3 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 3 1 1 0 5 1 0 1 1 1 0 0 1 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 1 1 1 0 7 0 0 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
5 18 26 19
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
4 23 20 21
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 9 37 17
COX1 (size: 1554 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.09%)
Alanine (Ala, A)
n = 40 (7.74%)
Serine (Ser, S)
n = 30 (5.8%)
Threonine (Thr, T)
n = 39 (7.54%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 42 (8.12%)
Leucine (Leu, L)
n = 62 (11.99%)
Isoleucine (Ile, I)
n = 33 (6.38%)
Methionine (Met, M)
n = 33 (6.38%)
Proline (Pro, P)
n = 29 (5.61%)
Phenylalanine (Phe, F)
n = 42 (8.12%)
Tyrosine (Tyr, Y)
n = 19 (3.68%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.9%)
Glutamic acid (Glu, E)
n = 10 (1.93%)
Asparagine (Asn, N)
n = 17 (3.29%)
Glutamine (Gln, Q)
n = 6 (1.16%)
Histidine (His, H)
n = 18 (3.48%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
25 8 23 9 4 25 6 12 5 1 6 11 16 9 25 17
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
10 1 0 14 11 15 0 9 11 18 9 14 8 6 1 16
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 13 3 7 5 13 2 1 2 9 10 4 6 13 4 8
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 9 1 8 7 8 1 1 1 6 0 0 0 1 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
154 105 134 125
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 135 95 212
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
53 116 183 166
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.96%)
Alanine (Ala, A)
n = 7 (3.08%)
Serine (Ser, S)
n = 21 (9.25%)
Threonine (Thr, T)
n = 18 (7.93%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 13 (5.73%)
Leucine (Leu, L)
n = 34 (14.98%)
Isoleucine (Ile, I)
n = 19 (8.37%)
Methionine (Met, M)
n = 14 (6.17%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 7 (3.08%)
Tyrosine (Tyr, Y)
n = 11 (4.85%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 10 (4.41%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 4 (1.76%)
Glutamine (Gln, Q)
n = 7 (3.08%)
Histidine (His, H)
n = 7 (3.08%)
Lysine (Lys, K)
n = 5 (2.2%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 7 8 3 5 14 5 5 6 1 1 4 6 2 4 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 2 2 3 2 0 4 2 3 0 4 4 5 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 6 2 3 5 7 0 3 3 8 3 0 2 1 3 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 10 5 5 5 2 3 0 1 5 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
54 60 66 48
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
28 53 60 87
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
26 59 85 58
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 14 (5.38%)
Serine (Ser, S)
n = 22 (8.46%)
Threonine (Thr, T)
n = 23 (8.85%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 16 (6.15%)
Leucine (Leu, L)
n = 33 (12.69%)
Isoleucine (Ile, I)
n = 15 (5.77%)
Methionine (Met, M)
n = 10 (3.85%)
Proline (Pro, P)
n = 11 (4.23%)
Phenylalanine (Phe, F)
n = 22 (8.46%)
Tyrosine (Tyr, Y)
n = 13 (5.0%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 6 (2.31%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 5 7 3 6 11 5 7 7 0 5 4 6 1 8 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 1 5 6 3 0 5 4 8 3 1 4 6 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 9 1 1 7 7 2 1 4 7 6 3 1 1 5 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 8 0 2 1 3 0 1 1 2 1 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
61 64 62 74
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 65 56 96
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 89 93 59
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (6.86%)
Alanine (Ala, A)
n = 23 (6.07%)
Serine (Ser, S)
n = 26 (6.86%)
Threonine (Thr, T)
n = 24 (6.33%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 19 (5.01%)
Leucine (Leu, L)
n = 58 (15.3%)
Isoleucine (Ile, I)
n = 40 (10.55%)
Methionine (Met, M)
n = 13 (3.43%)
Proline (Pro, P)
n = 24 (6.33%)
Phenylalanine (Phe, F)
n = 26 (6.86%)
Tyrosine (Tyr, Y)
n = 15 (3.96%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 12 (3.17%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 14 (3.69%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 13 (3.43%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 9 (2.37%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 24 9 6 11 24 4 11 5 1 3 5 11 0 8 18
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 3 2 12 8 1 2 10 13 1 5 10 8 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 10 0 3 8 13 0 1 1 7 8 3 2 5 9 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 4 2 5 7 9 0 0 2 6 1 1 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
86 97 103 94
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
54 95 75 156
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 145 141 74
ND1 (size: 956 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.79%)
Alanine (Ala, A)
n = 29 (9.15%)
Serine (Ser, S)
n = 20 (6.31%)
Threonine (Thr, T)
n = 27 (8.52%)
Cysteine (Cys, C)
n = 1 (0.32%)
Valine (Val, V)
n = 14 (4.42%)
Leucine (Leu, L)
n = 54 (17.03%)
Isoleucine (Ile, I)
n = 29 (9.15%)
Methionine (Met, M)
n = 19 (5.99%)
Proline (Pro, P)
n = 22 (6.94%)
Phenylalanine (Phe, F)
n = 20 (6.31%)
Tyrosine (Tyr, Y)
n = 13 (4.1%)
Tryptophan (Trp, W)
n = 9 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.95%)
Glutamic acid (Glu, E)
n = 11 (3.47%)
Asparagine (Asn, N)
n = 11 (3.47%)
Glutamine (Gln, Q)
n = 6 (1.89%)
Histidine (His, H)
n = 3 (0.95%)
Lysine (Lys, K)
n = 7 (2.21%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 21 18 7 10 29 4 4 6 0 3 3 7 1 5 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 0 7 12 10 0 2 2 6 2 3 10 9 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 14 0 3 7 6 0 2 2 5 8 2 0 2 9 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 9 2 0 3 7 0 1 1 5 1 0 0 0 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 89 97 63
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 94 54 136
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 116 137 52
ND2 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 20 (5.78%)
Serine (Ser, S)
n = 26 (7.51%)
Threonine (Thr, T)
n = 39 (11.27%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 10 (2.89%)
Leucine (Leu, L)
n = 51 (14.74%)
Isoleucine (Ile, I)
n = 38 (10.98%)
Methionine (Met, M)
n = 40 (11.56%)
Proline (Pro, P)
n = 20 (5.78%)
Phenylalanine (Phe, F)
n = 12 (3.47%)
Tyrosine (Tyr, Y)
n = 10 (2.89%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 7 (2.02%)
Asparagine (Asn, N)
n = 14 (4.05%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 4 (1.16%)
Lysine (Lys, K)
n = 15 (4.34%)
Arginine (Arg, R)
n = 5 (1.45%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 25 40 5 7 31 3 4 7 2 3 1 5 1 4 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
0 0 1 3 9 8 0 0 7 7 0 1 13 5 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 21 0 3 9 11 2 0 1 1 9 0 1 2 12 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 6 1 1 1 14 1 0 1 4 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
53 84 147 63
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 104 61 151
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 123 173 39
ND3 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 20 (5.78%)
Serine (Ser, S)
n = 26 (7.51%)
Threonine (Thr, T)
n = 39 (11.27%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 10 (2.89%)
Leucine (Leu, L)
n = 51 (14.74%)
Isoleucine (Ile, I)
n = 38 (10.98%)
Methionine (Met, M)
n = 40 (11.56%)
Proline (Pro, P)
n = 20 (5.78%)
Phenylalanine (Phe, F)
n = 12 (3.47%)
Tyrosine (Tyr, Y)
n = 10 (2.89%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 7 (2.02%)
Asparagine (Asn, N)
n = 14 (4.05%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 4 (1.16%)
Lysine (Lys, K)
n = 15 (4.34%)
Arginine (Arg, R)
n = 5 (1.45%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 25 40 5 7 31 3 4 7 2 3 1 5 1 4 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
0 0 1 3 9 8 0 0 7 7 0 1 13 5 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 21 0 3 9 11 2 0 1 1 9 0 1 2 12 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 6 1 1 1 14 1 0 1 4 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
53 84 147 63
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 104 61 151
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 123 173 39
ND4 (size: 1369 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.96%)
Alanine (Ala, A)
n = 35 (7.69%)
Serine (Ser, S)
n = 35 (7.69%)
Threonine (Thr, T)
n = 40 (8.79%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 16 (3.52%)
Leucine (Leu, L)
n = 92 (20.22%)
Isoleucine (Ile, I)
n = 41 (9.01%)
Methionine (Met, M)
n = 34 (7.47%)
Proline (Pro, P)
n = 21 (4.62%)
Phenylalanine (Phe, F)
n = 15 (3.3%)
Tyrosine (Tyr, Y)
n = 17 (3.74%)
Tryptophan (Trp, W)
n = 13 (2.86%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 8 (1.76%)
Asparagine (Asn, N)
n = 22 (4.84%)
Glutamine (Gln, Q)
n = 11 (2.42%)
Histidine (His, H)
n = 9 (1.98%)
Lysine (Lys, K)
n = 13 (2.86%)
Arginine (Arg, R)
n = 10 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 22 27 11 18 37 11 13 10 1 0 6 9 1 4 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 2 1 7 18 9 1 2 7 7 2 4 11 6 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 21 2 4 6 15 0 2 8 5 12 4 2 6 16 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 6 2 0 3 12 1 0 2 8 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
80 128 160 88
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
54 121 83 198
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
34 157 189 76
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 6 (6.12%)
Serine (Ser, S)
n = 9 (9.18%)
Threonine (Thr, T)
n = 6 (6.12%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 7 (7.14%)
Leucine (Leu, L)
n = 21 (21.43%)
Isoleucine (Ile, I)
n = 5 (5.1%)
Methionine (Met, M)
n = 13 (13.27%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 5 (5.1%)
Tyrosine (Tyr, Y)
n = 4 (4.08%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 6 (6.12%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 3 7 0 3 10 3 5 2 0 1 1 4 1 1 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 2 2 1 2 1 1 2 1 0 0 1 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 3 0 0 5 3 0 0 1 2 2 0 0 3 3 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 1 0 1 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
20 22 31 26
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 21 18 51
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 31 40 16
ND5 (size: 1821 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (4.62%)
Alanine (Ala, A)
n = 42 (6.93%)
Serine (Ser, S)
n = 55 (9.08%)
Threonine (Thr, T)
n = 50 (8.25%)
Cysteine (Cys, C)
n = 4 (0.66%)
Valine (Val, V)
n = 20 (3.3%)
Leucine (Leu, L)
n = 90 (14.85%)
Isoleucine (Ile, I)
n = 54 (8.91%)
Methionine (Met, M)
n = 39 (6.44%)
Proline (Pro, P)
n = 26 (4.29%)
Phenylalanine (Phe, F)
n = 44 (7.26%)
Tyrosine (Tyr, Y)
n = 20 (3.3%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 10 (1.65%)
Glutamic acid (Glu, E)
n = 11 (1.82%)
Asparagine (Asn, N)
n = 31 (5.12%)
Glutamine (Gln, Q)
n = 20 (3.3%)
Histidine (His, H)
n = 16 (2.64%)
Lysine (Lys, K)
n = 25 (4.13%)
Arginine (Arg, R)
n = 9 (1.49%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 34 35 11 24 35 5 11 17 3 5 6 9 0 19 25
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 2 2 3 24 15 0 5 5 16 2 5 8 12 1 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 16 4 9 14 13 5 5 9 12 8 3 4 10 21 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 8 3 5 5 20 5 1 3 4 1 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
111 146 213 137
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
67 159 134 247
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
40 218 221 128
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (13.71%)
Alanine (Ala, A)
n = 12 (6.86%)
Serine (Ser, S)
n = 12 (6.86%)
Threonine (Thr, T)
n = 12 (6.86%)
Cysteine (Cys, C)
n = 2 (1.14%)
Valine (Val, V)
n = 22 (12.57%)
Leucine (Leu, L)
n = 18 (10.29%)
Isoleucine (Ile, I)
n = 13 (7.43%)
Methionine (Met, M)
n = 7 (4.0%)
Proline (Pro, P)
n = 4 (2.29%)
Phenylalanine (Phe, F)
n = 14 (8.0%)
Tyrosine (Tyr, Y)
n = 9 (5.14%)
Tryptophan (Trp, W)
n = 4 (2.29%)
Aspartic acid (Asp, D)
n = 4 (2.29%)
Glutamic acid (Glu, E)
n = 9 (5.14%)
Asparagine (Asn, N)
n = 4 (2.29%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 4 (2.29%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 0 3 2 0 1 2 7 0 0 6 1 4 11 13 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 2 5 1 5 1 14 0 5 5 3 1 0 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 3 3 3 1 2 1 3 2 8 1 4 6 3 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 3 6 3 1 1 3 1 0 0 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 10 45 50
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 35 31 74
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
46 13 35 82
Total protein-coding genes (size: 11407 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 216 (5.69%)
Alanine (Ala, A)
n = 259 (6.82%)
Serine (Ser, S)
n = 284 (7.48%)
Threonine (Thr, T)
n = 316 (8.32%)
Cysteine (Cys, C)
n = 24 (0.63%)
Valine (Val, V)
n = 196 (5.16%)
Leucine (Leu, L)
n = 589 (15.5%)
Isoleucine (Ile, I)
n = 323 (8.5%)
Methionine (Met, M)
n = 243 (6.4%)
Proline (Pro, P)
n = 199 (5.24%)
Phenylalanine (Phe, F)
n = 230 (6.05%)
Tyrosine (Tyr, Y)
n = 138 (3.63%)
Tryptophan (Trp, W)
n = 104 (2.74%)
Aspartic acid (Asp, D)
n = 67 (1.76%)
Glutamic acid (Glu, E)
n = 98 (2.58%)
Asparagine (Asn, N)
n = 146 (3.84%)
Glutamine (Gln, Q)
n = 91 (2.4%)
Histidine (His, H)
n = 97 (2.55%)
Lysine (Lys, K)
n = 105 (2.76%)
Arginine (Arg, R)
n = 67 (1.76%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
163 160 193 66 96 247 59 96 81 10 34 48 85 29 104 126
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
50 10 14 59 111 83 6 46 51 95 24 49 81 65 4 66
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
103 131 16 42 71 101 13 19 38 66 72 24 25 54 92 31
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
66 73 25 31 36 90 15 6 14 43 4 1 0 7 0 80
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
836 922 1191 851
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
469 1001 749 1581
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
304 1179 1471 846

F a i l e d  t o  u n d e r s t a n d  i d :  ? t e r m = ( " P a n t h e r a  l e o " [ O r g a n i s m ] )  A N D  ( r e f s e q [ f i l t e r ]  A N D  m i t o c h o n d r i o n [ f i l t e r ] ) 



Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.