Viewing data for Muntiacus reevesi


Scientific name Muntiacus reevesi
Common name Reeves's muntjac
Maximum lifespan 23.20 years (Muntiacus reevesi@AnAge)

Total mtDNA (size: 16354 bases) GC AT G C A T
Base content (bases) 6190 10164 3990 2200 4744 5420
Base content per 1 kb (bases) 379 621 244 135 290 331
Base content (%) 37.9% 62.1%
Total protein-coding genes (size: 11341 bases) GC AT G C A T
Base content (bases) 4312 7029 2930 1382 3384 3645
Base content per 1 kb (bases) 380 620 258 122 298 321
Base content (%) 38.0% 62.0%
D-loop (size: 919 bases) GC AT G C A T
Base content (bases) 359 560 219 140 287 273
Base content per 1 kb (bases) 391 609 238 152 312 297
Base content (%) 39.1% 60.9%
Total tRNA-coding genes (size: 1517 bases) GC AT G C A T
Base content (bases) 551 966 314 237 425 541
Base content per 1 kb (bases) 363 637 207 156 280 357
Base content (%) 36.3% 63.7%
Total rRNA-coding genes (size: 2526 bases) GC AT G C A T
Base content (bases) 949 1577 516 433 636 941
Base content per 1 kb (bases) 376 624 204 171 252 373
Base content (%) 37.6% 62.4%
12S rRNA gene (size: 959 bases) GC AT G C A T
Base content (bases) 379 580 207 172 233 347
Base content per 1 kb (bases) 395 605 216 179 243 362
Base content (%) 39.5% 60.5%
16S rRNA gene (size: 1567 bases) GC AT G C A T
Base content (bases) 570 997 309 261 403 594
Base content per 1 kb (bases) 364 636 197 167 257 379
Base content (%) 36.4% 63.6%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 267 414 185 82 204 210
Base content per 1 kb (bases) 392 608 272 120 300 308
Base content (%) 39.2% 60.8%
ATP8 (size: 201 bases) GC AT G C A T
Base content (bases) 61 140 49 12 59 81
Base content per 1 kb (bases) 303 697 244 60 294 403
Base content (%) 30.3% 69.7%
COX1 (size: 1545 bases) GC AT G C A T
Base content (bases) 611 934 359 252 484 450
Base content per 1 kb (bases) 395 605 232 163 313 291
Base content (%) 39.5% 60.5%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 248 436 154 94 200 236
Base content per 1 kb (bases) 363 637 225 137 292 345
Base content (%) 36.3% 63.7%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 334 450 220 114 235 215
Base content per 1 kb (bases) 426 574 281 145 300 274
Base content (%) 42.6% 57.4%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 449 691 302 147 338 353
Base content per 1 kb (bases) 394 606 265 129 296 310
Base content (%) 39.4% 60.6%
ND1 (size: 957 bases) GC AT G C A T
Base content (bases) 370 587 252 118 292 295
Base content per 1 kb (bases) 387 613 263 123 305 308
Base content (%) 38.7% 61.3%
ND2 (size: 1044 bases) GC AT G C A T
Base content (bases) 360 684 262 98 308 376
Base content per 1 kb (bases) 345 655 251 94 295 360
Base content (%) 34.5% 65.5%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 131 215 90 41 106 109
Base content per 1 kb (bases) 379 621 260 118 306 315
Base content (%) 37.9% 62.1%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 526 852 374 152 421 431
Base content per 1 kb (bases) 382 618 271 110 306 313
Base content (%) 38.2% 61.8%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 108 189 70 38 100 89
Base content per 1 kb (bases) 364 636 236 128 337 300
Base content (%) 36.4% 63.6%
ND5 (size: 1821 bases) GC AT G C A T
Base content (bases) 673 1148 476 197 541 607
Base content per 1 kb (bases) 370 630 261 108 297 333
Base content (%) 37.0% 63.0%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 192 336 149 43 119 217
Base content per 1 kb (bases) 364 636 282 81 225 411
Base content (%) 36.4% 63.6%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (5.31%)
Alanine (Ala, A)
n = 17 (7.52%)
Serine (Ser, S)
n = 14 (6.19%)
Threonine (Thr, T)
n = 26 (11.5%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (3.98%)
Leucine (Leu, L)
n = 44 (19.47%)
Isoleucine (Ile, I)
n = 25 (11.06%)
Methionine (Met, M)
n = 12 (5.31%)
Proline (Pro, P)
n = 12 (5.31%)
Phenylalanine (Phe, F)
n = 12 (5.31%)
Tyrosine (Tyr, Y)
n = 2 (0.88%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 11 (4.87%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 6 (2.65%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 4 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 6 10 13 5 16 3 7 8 1 1 1 5 2 7 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 2 9 6 0 2 3 6 1 3 1 7 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 13 1 2 2 4 1 3 2 1 1 1 0 4 7 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 1 2 0 1 3 1 1 2 1 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
42 68 83 34
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
24 64 37 102
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 53 90 68
ATP8 (size: 201 bases)
Amino acid sequence: MPQLDTSTWFIMIMSMFLVLFIIFQLKISKHSFYFNPEPMLTKTQKQNIPWETKWTKIYLPLLLPQ*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 4 (6.06%)
Threonine (Thr, T)
n = 6 (9.09%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.52%)
Leucine (Leu, L)
n = 9 (13.64%)
Isoleucine (Ile, I)
n = 7 (10.61%)
Methionine (Met, M)
n = 5 (7.58%)
Proline (Pro, P)
n = 6 (9.09%)
Phenylalanine (Phe, F)
n = 6 (9.09%)
Tyrosine (Tyr, Y)
n = 2 (3.03%)
Tryptophan (Trp, W)
n = 3 (4.55%)
Aspartic acid (Asp, D)
n = 1 (1.52%)
Glutamic acid (Glu, E)
n = 2 (3.03%)
Asparagine (Asn, N)
n = 2 (3.03%)
Glutamine (Gln, Q)
n = 5 (7.58%)
Histidine (His, H)
n = 1 (1.52%)
Lysine (Lys, K)
n = 6 (9.09%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 3 4 1 1 3 0 3 5 0 1 0 0 0 1 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 0 0 0 0 0 0 2 2 2 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 3 2 0 1 2 0 0 1 1 1 0 1 1 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 1 0 6 0 0 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
4 17 27 19
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
4 15 20 28
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 17 34 12
COX1 (size: 1545 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.14%)
Alanine (Ala, A)
n = 39 (7.59%)
Serine (Ser, S)
n = 30 (5.84%)
Threonine (Thr, T)
n = 38 (7.39%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 37 (7.2%)
Leucine (Leu, L)
n = 60 (11.67%)
Isoleucine (Ile, I)
n = 39 (7.59%)
Methionine (Met, M)
n = 33 (6.42%)
Proline (Pro, P)
n = 28 (5.45%)
Phenylalanine (Phe, F)
n = 42 (8.17%)
Tyrosine (Tyr, Y)
n = 19 (3.7%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 14 (2.72%)
Glutamic acid (Glu, E)
n = 10 (1.95%)
Asparagine (Asn, N)
n = 20 (3.89%)
Glutamine (Gln, Q)
n = 6 (1.17%)
Histidine (His, H)
n = 17 (3.31%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
31 8 26 10 5 25 7 12 6 0 12 3 20 2 23 19
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 1 0 13 11 15 0 7 10 24 6 10 6 12 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 21 1 10 3 13 1 0 3 12 7 1 1 9 11 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 9 1 4 10 7 2 1 2 5 0 0 0 1 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
147 106 142 120
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 132 96 211
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
29 121 212 153
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 8 (3.52%)
Serine (Ser, S)
n = 21 (9.25%)
Threonine (Thr, T)
n = 18 (7.93%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 13 (5.73%)
Leucine (Leu, L)
n = 34 (14.98%)
Isoleucine (Ile, I)
n = 17 (7.49%)
Methionine (Met, M)
n = 16 (7.05%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 6 (2.64%)
Tyrosine (Tyr, Y)
n = 10 (4.41%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 10 (4.41%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 5 (2.2%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 8 (3.52%)
Lysine (Lys, K)
n = 6 (2.64%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 6 13 3 1 12 1 15 6 0 5 2 4 2 3 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 2 2 3 3 0 2 1 5 0 2 4 7 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 12 0 8 3 4 1 1 4 6 4 1 2 2 3 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 12 3 5 5 5 1 0 1 5 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
54 50 67 57
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 55 61 86
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 49 108 57
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 15 (5.77%)
Serine (Ser, S)
n = 20 (7.69%)
Threonine (Thr, T)
n = 23 (8.85%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 15 (5.77%)
Leucine (Leu, L)
n = 32 (12.31%)
Isoleucine (Ile, I)
n = 17 (6.54%)
Methionine (Met, M)
n = 9 (3.46%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 7 (2.69%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 3 8 7 3 14 3 5 7 0 2 8 5 0 11 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 2 5 5 5 0 1 10 9 0 3 3 6 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 9 1 3 3 8 1 3 2 6 5 2 0 2 5 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 7 1 1 2 2 0 0 3 2 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
61 68 63 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 65 55 97
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 87 97 68
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.33%)
Alanine (Ala, A)
n = 24 (6.33%)
Serine (Ser, S)
n = 23 (6.07%)
Threonine (Thr, T)
n = 25 (6.6%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 18 (4.75%)
Leucine (Leu, L)
n = 59 (15.57%)
Isoleucine (Ile, I)
n = 44 (11.61%)
Methionine (Met, M)
n = 13 (3.43%)
Proline (Pro, P)
n = 23 (6.07%)
Phenylalanine (Phe, F)
n = 26 (6.86%)
Tyrosine (Tyr, Y)
n = 14 (3.69%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 18 (4.75%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
28 16 12 7 14 28 3 6 5 1 6 4 8 0 14 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 4 2 4 18 0 1 6 14 3 3 6 12 2 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 17 0 5 5 9 1 1 2 10 4 0 1 10 8 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 6 0 4 7 9 0 0 1 7 0 1 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
83 101 113 83
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 92 76 160
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 109 164 95
ND1 (size: 957 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.77%)
Alanine (Ala, A)
n = 28 (8.81%)
Serine (Ser, S)
n = 23 (7.23%)
Threonine (Thr, T)
n = 18 (5.66%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 14 (4.4%)
Leucine (Leu, L)
n = 56 (17.61%)
Isoleucine (Ile, I)
n = 34 (10.69%)
Methionine (Met, M)
n = 18 (5.66%)
Proline (Pro, P)
n = 22 (6.92%)
Phenylalanine (Phe, F)
n = 22 (6.92%)
Tyrosine (Tyr, Y)
n = 11 (3.46%)
Tryptophan (Trp, W)
n = 9 (2.83%)
Aspartic acid (Asp, D)
n = 3 (0.94%)
Glutamic acid (Glu, E)
n = 11 (3.46%)
Asparagine (Asn, N)
n = 12 (3.77%)
Glutamine (Gln, Q)
n = 7 (2.2%)
Histidine (His, H)
n = 3 (0.94%)
Lysine (Lys, K)
n = 6 (1.89%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 15 14 5 7 27 4 13 7 0 1 3 9 1 13 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 4 10 14 0 0 6 4 2 5 9 7 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 14 0 4 5 10 0 1 3 8 3 1 0 6 6 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 10 1 2 1 5 1 0 1 6 1 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 83 92 76
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 87 54 144
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 82 149 72
ND2 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.03%)
Alanine (Ala, A)
n = 18 (5.19%)
Serine (Ser, S)
n = 28 (8.07%)
Threonine (Thr, T)
n = 36 (10.37%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 12 (3.46%)
Leucine (Leu, L)
n = 54 (15.56%)
Isoleucine (Ile, I)
n = 36 (10.37%)
Methionine (Met, M)
n = 43 (12.39%)
Proline (Pro, P)
n = 21 (6.05%)
Phenylalanine (Phe, F)
n = 14 (4.03%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.88%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.44%)
Asparagine (Asn, N)
n = 16 (4.61%)
Glutamine (Gln, Q)
n = 10 (2.88%)
Histidine (His, H)
n = 5 (1.44%)
Lysine (Lys, K)
n = 13 (3.75%)
Arginine (Arg, R)
n = 3 (0.86%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 13 39 7 9 25 3 9 10 0 3 2 6 1 8 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 6 4 8 0 0 6 7 1 4 6 9 2 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 17 0 3 7 14 2 0 2 6 2 0 1 9 7 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 5 0 1 0 9 4 0 0 3 0 0 0 0 1 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
50 83 146 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 101 59 159
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 78 171 80
ND3 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.03%)
Alanine (Ala, A)
n = 18 (5.19%)
Serine (Ser, S)
n = 28 (8.07%)
Threonine (Thr, T)
n = 36 (10.37%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 12 (3.46%)
Leucine (Leu, L)
n = 54 (15.56%)
Isoleucine (Ile, I)
n = 36 (10.37%)
Methionine (Met, M)
n = 43 (12.39%)
Proline (Pro, P)
n = 21 (6.05%)
Phenylalanine (Phe, F)
n = 14 (4.03%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.88%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.44%)
Asparagine (Asn, N)
n = 16 (4.61%)
Glutamine (Gln, Q)
n = 10 (2.88%)
Histidine (His, H)
n = 5 (1.44%)
Lysine (Lys, K)
n = 13 (3.75%)
Arginine (Arg, R)
n = 3 (0.86%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 13 39 7 9 25 3 9 10 0 3 2 6 1 8 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 6 4 8 0 0 6 7 1 4 6 9 2 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 17 0 3 7 14 2 0 2 6 2 0 1 9 7 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 5 0 1 0 9 4 0 0 3 0 0 0 0 1 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
50 83 146 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 101 59 159
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 78 171 80
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.93%)
Alanine (Ala, A)
n = 27 (5.9%)
Serine (Ser, S)
n = 43 (9.39%)
Threonine (Thr, T)
n = 39 (8.52%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 17 (3.71%)
Leucine (Leu, L)
n = 95 (20.74%)
Isoleucine (Ile, I)
n = 39 (8.52%)
Methionine (Met, M)
n = 32 (6.99%)
Proline (Pro, P)
n = 19 (4.15%)
Phenylalanine (Phe, F)
n = 21 (4.59%)
Tyrosine (Tyr, Y)
n = 16 (3.49%)
Tryptophan (Trp, W)
n = 13 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 9 (1.97%)
Asparagine (Asn, N)
n = 21 (4.59%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 12 (2.62%)
Lysine (Lys, K)
n = 11 (2.4%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
31 8 27 13 19 37 4 16 11 0 4 5 7 1 11 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 2 1 3 12 10 2 3 7 8 0 3 8 8 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 20 0 8 11 10 1 4 9 9 7 0 6 9 12 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 8 1 1 2 10 1 1 1 8 0 0 0 0 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 125 155 105
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
57 115 83 204
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 134 193 111
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 8 (8.16%)
Serine (Ser, S)
n = 10 (10.2%)
Threonine (Thr, T)
n = 6 (6.12%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 7 (7.14%)
Leucine (Leu, L)
n = 23 (23.47%)
Isoleucine (Ile, I)
n = 4 (4.08%)
Methionine (Met, M)
n = 11 (11.22%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 4 (4.08%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 5 (5.1%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 1 6 2 3 10 1 7 2 0 1 1 5 0 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 3 2 0 6 0 2 0 2 0 1 0 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 2 1 2 6 1 0 0 1 3 1 0 0 3 2 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 0 1 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
22 22 27 28
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 24 17 49
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 24 45 23
ND5 (size: 1821 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (4.62%)
Alanine (Ala, A)
n = 45 (7.43%)
Serine (Ser, S)
n = 48 (7.92%)
Threonine (Thr, T)
n = 51 (8.42%)
Cysteine (Cys, C)
n = 5 (0.83%)
Valine (Val, V)
n = 15 (2.48%)
Leucine (Leu, L)
n = 85 (14.03%)
Isoleucine (Ile, I)
n = 62 (10.23%)
Methionine (Met, M)
n = 43 (7.1%)
Proline (Pro, P)
n = 26 (4.29%)
Phenylalanine (Phe, F)
n = 50 (8.25%)
Tyrosine (Tyr, Y)
n = 15 (2.48%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 10 (1.65%)
Glutamic acid (Glu, E)
n = 12 (1.98%)
Asparagine (Asn, N)
n = 37 (6.11%)
Glutamine (Gln, Q)
n = 18 (2.97%)
Histidine (His, H)
n = 13 (2.15%)
Lysine (Lys, K)
n = 23 (3.8%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
39 23 39 12 12 40 3 17 18 0 1 6 7 1 29 21
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 2 3 9 15 19 2 4 11 11 2 6 9 11 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 28 1 12 9 12 1 4 10 5 10 0 1 12 25 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 9 3 3 7 21 2 2 3 3 0 0 0 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
110 132 230 135
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
67 156 129 255
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 188 248 151
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (14.86%)
Alanine (Ala, A)
n = 8 (4.57%)
Serine (Ser, S)
n = 12 (6.86%)
Threonine (Thr, T)
n = 9 (5.14%)
Cysteine (Cys, C)
n = 1 (0.57%)
Valine (Val, V)
n = 21 (12.0%)
Leucine (Leu, L)
n = 19 (10.86%)
Isoleucine (Ile, I)
n = 17 (9.71%)
Methionine (Met, M)
n = 10 (5.71%)
Proline (Pro, P)
n = 3 (1.71%)
Phenylalanine (Phe, F)
n = 13 (7.43%)
Tyrosine (Tyr, Y)
n = 10 (5.71%)
Tryptophan (Trp, W)
n = 4 (2.29%)
Aspartic acid (Asp, D)
n = 4 (2.29%)
Glutamic acid (Glu, E)
n = 9 (5.14%)
Asparagine (Asn, N)
n = 3 (1.71%)
Glutamine (Gln, Q)
n = 2 (1.14%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 3 (1.71%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 1 5 2 0 0 0 11 1 1 7 1 7 6 13 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 0 4 1 1 2 10 1 7 8 3 0 0 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 2 3 5 0 0 2 5 0 8 2 2 6 2 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 7 3 1 1 2 1 0 0 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 8 47 53
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 27 32 80
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
44 8 40 84
Total protein-coding genes (size: 11406 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 216 (5.68%)
Alanine (Ala, A)
n = 247 (6.5%)
Serine (Ser, S)
n = 283 (7.45%)
Threonine (Thr, T)
n = 304 (8.0%)
Cysteine (Cys, C)
n = 23 (0.61%)
Valine (Val, V)
n = 183 (4.82%)
Leucine (Leu, L)
n = 597 (15.71%)
Isoleucine (Ile, I)
n = 346 (9.11%)
Methionine (Met, M)
n = 251 (6.61%)
Proline (Pro, P)
n = 192 (5.05%)
Phenylalanine (Phe, F)
n = 249 (6.55%)
Tyrosine (Tyr, Y)
n = 125 (3.29%)
Tryptophan (Trp, W)
n = 104 (2.74%)
Aspartic acid (Asp, D)
n = 64 (1.68%)
Glutamic acid (Glu, E)
n = 98 (2.58%)
Asparagine (Asn, N)
n = 163 (4.29%)
Glutamine (Gln, Q)
n = 92 (2.42%)
Histidine (His, H)
n = 96 (2.53%)
Lysine (Lys, K)
n = 95 (2.5%)
Arginine (Arg, R)
n = 63 (1.66%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
241 105 209 88 82 246 36 126 89 3 45 36 86 16 139 110
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
42 7 16 55 79 107 6 32 61 99 24 47 55 84 6 52
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
79 163 10 62 56 91 11 23 40 76 49 8 19 70 93 31
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
65 79 19 26 38 81 14 7 14 41 1 1 0 8 1 96
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
808 895 1223 875
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
470 963 742 1626
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
216 978 1606 1001

Failed to understand id: ?term=("Muntiacus reevesi"[Organism]) AND (refseq[filter] AND mitochondrion[filter])


Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.