Viewing data for Herpestes javanicus


Scientific name Herpestes javanicus
Common name Javan mongoose
Maximum lifespan 16.60 years (Herpestes javanicus@AnAge)

Total mtDNA (size: 16763 bases) GC AT G C A T
Base content (bases) 6674 10084 4372 2302 4505 5579
Base content per 1 kb (bases) 398 602 261 137 269 333
Base content (%) 39.8% 60.2%
Total protein-coding genes (size: 11341 bases) GC AT G C A T
Base content (bases) 4525 6813 3106 1419 3130 3683
Base content per 1 kb (bases) 399 601 274 125 276 325
Base content (%) 39.9% 60.1%
D-loop (size: 1318 bases) GC AT G C A T
Base content (bases) 543 775 351 192 363 412
Base content per 1 kb (bases) 412 588 266 146 275 313
Base content (%) 41.2% 58.8%
Total tRNA-coding genes (size: 1510 bases) GC AT G C A T
Base content (bases) 546 964 313 233 434 530
Base content per 1 kb (bases) 362 638 207 154 287 351
Base content (%) 36.2% 63.8%
Total rRNA-coding genes (size: 2534 bases) GC AT G C A T
Base content (bases) 1030 1502 584 446 566 936
Base content per 1 kb (bases) 406 593 230 176 223 369
Base content (%) 40.6% 59.3%
12S rRNA gene (size: 957 bases) GC AT G C A T
Base content (bases) 409 548 241 168 202 346
Base content per 1 kb (bases) 427 573 252 176 211 362
Base content (%) 42.7% 57.3%
16S rRNA gene (size: 1577 bases) GC AT G C A T
Base content (bases) 621 954 343 278 364 590
Base content per 1 kb (bases) 394 605 218 176 231 374
Base content (%) 39.4% 60.5%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 267 414 190 77 198 216
Base content per 1 kb (bases) 392 608 279 113 291 317
Base content (%) 39.2% 60.8%
ATP8 (size: 204 bases) GC AT G C A T
Base content (bases) 69 135 53 16 53 82
Base content per 1 kb (bases) 338 662 260 78 260 402
Base content (%) 33.8% 66.2%
COX1 (size: 1545 bases) GC AT G C A T
Base content (bases) 649 896 377 272 474 422
Base content per 1 kb (bases) 420 580 244 176 307 273
Base content (%) 42.0% 58.0%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 252 432 160 92 192 240
Base content per 1 kb (bases) 368 632 234 135 281 351
Base content (%) 36.8% 63.2%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 334 450 211 123 234 216
Base content per 1 kb (bases) 426 574 269 157 298 276
Base content (%) 42.6% 57.4%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 479 661 337 142 303 358
Base content per 1 kb (bases) 420 580 296 125 266 314
Base content (%) 42.0% 58.0%
ND1 (size: 957 bases) GC AT G C A T
Base content (bases) 396 561 283 113 256 305
Base content per 1 kb (bases) 414 586 296 118 268 319
Base content (%) 41.4% 58.6%
ND2 (size: 1044 bases) GC AT G C A T
Base content (bases) 403 641 310 93 257 384
Base content per 1 kb (bases) 386 614 297 89 246 368
Base content (%) 38.6% 61.4%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 138 208 91 47 102 106
Base content per 1 kb (bases) 399 601 263 136 295 306
Base content (%) 39.9% 60.1%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 533 845 378 155 382 463
Base content per 1 kb (bases) 387 613 274 112 277 336
Base content (%) 38.7% 61.3%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 113 184 77 36 98 86
Base content per 1 kb (bases) 380 620 259 121 330 290
Base content (%) 38.0% 62.0%
ND5 (size: 1821 bases) GC AT G C A T
Base content (bases) 716 1102 506 210 501 601
Base content per 1 kb (bases) 393 605 278 115 275 330
Base content (%) 39.3% 60.5%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 200 328 150 50 99 229
Base content per 1 kb (bases) 379 621 284 95 188 434
Base content (%) 37.9% 62.1%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.87%)
Alanine (Ala, A)
n = 16 (7.08%)
Serine (Ser, S)
n = 14 (6.19%)
Threonine (Thr, T)
n = 21 (9.29%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 10 (4.42%)
Leucine (Leu, L)
n = 42 (18.58%)
Isoleucine (Ile, I)
n = 27 (11.95%)
Methionine (Met, M)
n = 14 (6.19%)
Proline (Pro, P)
n = 13 (5.75%)
Phenylalanine (Phe, F)
n = 13 (5.75%)
Tyrosine (Tyr, Y)
n = 2 (0.88%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 11 (4.87%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 8 (3.54%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 4 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 9 10 9 2 22 4 3 8 1 1 2 7 0 7 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 4 10 2 0 1 3 6 1 2 4 7 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 12 1 2 2 6 0 1 3 1 1 0 2 5 6 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 3 0 0 1 3 1 0 1 3 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
41 71 81 34
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
22 60 39 106
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 59 96 58
ATP8 (size: 204 bases)
Amino acid sequence: MPQLDTSTWFITIVSMITTLFIVFQLKLSKHLYPSNPELKSTISLKQPTPWEKKWTKIYSPLSLPQQ*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 8 (11.94%)
Threonine (Thr, T)
n = 8 (11.94%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 2 (2.99%)
Leucine (Leu, L)
n = 9 (13.43%)
Isoleucine (Ile, I)
n = 6 (8.96%)
Methionine (Met, M)
n = 2 (2.99%)
Proline (Pro, P)
n = 7 (10.45%)
Phenylalanine (Phe, F)
n = 3 (4.48%)
Tyrosine (Tyr, Y)
n = 2 (2.99%)
Tryptophan (Trp, W)
n = 3 (4.48%)
Aspartic acid (Asp, D)
n = 1 (1.49%)
Glutamic acid (Glu, E)
n = 2 (2.99%)
Asparagine (Asn, N)
n = 1 (1.49%)
Glutamine (Gln, Q)
n = 5 (7.46%)
Histidine (His, H)
n = 1 (1.49%)
Lysine (Lys, K)
n = 7 (10.45%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 3 1 1 0 4 0 4 5 0 0 0 1 1 1 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 0 0 0 0 0 0 2 2 2 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 4 2 0 1 6 1 0 0 1 1 0 0 0 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 1 1 0 1 6 1 0 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
5 18 24 21
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
3 23 20 22
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 12 38 10
COX1 (size: 1545 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 46 (8.95%)
Alanine (Ala, A)
n = 42 (8.17%)
Serine (Ser, S)
n = 32 (6.23%)
Threonine (Thr, T)
n = 35 (6.81%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 38 (7.39%)
Leucine (Leu, L)
n = 57 (11.09%)
Isoleucine (Ile, I)
n = 36 (7.0%)
Methionine (Met, M)
n = 35 (6.81%)
Proline (Pro, P)
n = 28 (5.45%)
Phenylalanine (Phe, F)
n = 43 (8.37%)
Tyrosine (Tyr, Y)
n = 19 (3.7%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 17 (3.31%)
Glutamic acid (Glu, E)
n = 10 (1.95%)
Asparagine (Asn, N)
n = 16 (3.11%)
Glutamine (Gln, Q)
n = 6 (1.17%)
Histidine (His, H)
n = 18 (3.5%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 9 (1.75%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 15 27 11 7 22 4 10 4 2 8 6 15 9 14 29
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 1 0 11 13 15 3 8 14 19 5 9 4 14 1 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 20 0 11 7 9 2 1 2 15 4 3 3 7 9 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 9 1 8 9 9 0 3 0 4 2 0 0 1 0 14
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
153 105 134 123
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 134 96 209
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
43 138 192 142
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.96%)
Alanine (Ala, A)
n = 7 (3.08%)
Serine (Ser, S)
n = 21 (9.25%)
Threonine (Thr, T)
n = 18 (7.93%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 11 (4.85%)
Leucine (Leu, L)
n = 34 (14.98%)
Isoleucine (Ile, I)
n = 19 (8.37%)
Methionine (Met, M)
n = 15 (6.61%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 7 (3.08%)
Tyrosine (Tyr, Y)
n = 10 (4.41%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 10 (4.41%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 4 (1.76%)
Glutamine (Gln, Q)
n = 7 (3.08%)
Histidine (His, H)
n = 8 (3.52%)
Lysine (Lys, K)
n = 6 (2.64%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 8 10 4 1 18 0 11 6 1 2 1 8 0 3 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 2 0 2 3 2 0 0 4 5 0 4 5 3 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 9 1 3 2 9 1 2 4 5 5 0 0 2 2 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 13 2 7 3 5 1 0 0 6 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
52 57 68 51
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
28 53 61 86
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 50 111 55
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 14 (5.38%)
Serine (Ser, S)
n = 20 (7.69%)
Threonine (Thr, T)
n = 25 (9.62%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 16 (6.15%)
Leucine (Leu, L)
n = 32 (12.31%)
Isoleucine (Ile, I)
n = 16 (6.15%)
Methionine (Met, M)
n = 10 (3.85%)
Proline (Pro, P)
n = 11 (4.23%)
Phenylalanine (Phe, F)
n = 23 (8.85%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 7 (2.69%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 6 7 4 5 9 4 8 7 0 4 2 8 2 11 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 1 5 8 1 0 4 4 11 1 3 3 4 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 10 1 3 4 9 0 0 4 3 8 2 2 3 4 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 6 2 1 2 3 0 0 1 3 1 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
61 61 65 74
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 66 55 97
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 84 96 62
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (6.86%)
Alanine (Ala, A)
n = 23 (6.07%)
Serine (Ser, S)
n = 27 (7.12%)
Threonine (Thr, T)
n = 24 (6.33%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 17 (4.49%)
Leucine (Leu, L)
n = 56 (14.78%)
Isoleucine (Ile, I)
n = 39 (10.29%)
Methionine (Met, M)
n = 19 (5.01%)
Proline (Pro, P)
n = 22 (5.8%)
Phenylalanine (Phe, F)
n = 26 (6.86%)
Tyrosine (Tyr, Y)
n = 15 (3.96%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 7 (1.85%)
Asparagine (Asn, N)
n = 17 (4.49%)
Glutamine (Gln, Q)
n = 7 (1.85%)
Histidine (His, H)
n = 11 (2.9%)
Lysine (Lys, K)
n = 8 (2.11%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 24 16 5 14 33 0 4 6 1 1 4 11 1 9 17
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 4 3 10 10 0 3 7 16 0 0 7 15 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 12 0 6 3 17 0 0 1 6 9 0 0 3 14 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 7 0 1 10 7 1 0 2 6 0 1 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
84 100 109 87
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 95 76 157
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 142 173 59
ND1 (size: 957 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.77%)
Alanine (Ala, A)
n = 28 (8.81%)
Serine (Ser, S)
n = 22 (6.92%)
Threonine (Thr, T)
n = 23 (7.23%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 14 (4.4%)
Leucine (Leu, L)
n = 56 (17.61%)
Isoleucine (Ile, I)
n = 27 (8.49%)
Methionine (Met, M)
n = 22 (6.92%)
Proline (Pro, P)
n = 22 (6.92%)
Phenylalanine (Phe, F)
n = 19 (5.97%)
Tyrosine (Tyr, Y)
n = 11 (3.46%)
Tryptophan (Trp, W)
n = 9 (2.83%)
Aspartic acid (Asp, D)
n = 3 (0.94%)
Glutamic acid (Glu, E)
n = 11 (3.46%)
Asparagine (Asn, N)
n = 13 (4.09%)
Glutamine (Gln, Q)
n = 5 (1.57%)
Histidine (His, H)
n = 5 (1.57%)
Lysine (Lys, K)
n = 7 (2.2%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 17 19 3 10 32 4 7 5 0 1 3 10 0 10 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 6 15 6 1 2 2 7 1 3 7 12 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 13 0 0 8 10 0 0 4 4 7 1 0 5 8 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 11 0 2 1 7 0 1 1 5 1 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 89 96 66
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 91 56 138
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 103 153 52
ND2 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (4.32%)
Alanine (Ala, A)
n = 22 (6.34%)
Serine (Ser, S)
n = 29 (8.36%)
Threonine (Thr, T)
n = 39 (11.24%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 8 (2.31%)
Leucine (Leu, L)
n = 58 (16.71%)
Isoleucine (Ile, I)
n = 40 (11.53%)
Methionine (Met, M)
n = 33 (9.51%)
Proline (Pro, P)
n = 21 (6.05%)
Phenylalanine (Phe, F)
n = 12 (3.46%)
Tyrosine (Tyr, Y)
n = 9 (2.59%)
Tryptophan (Trp, W)
n = 10 (2.88%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 5 (1.44%)
Asparagine (Asn, N)
n = 13 (3.75%)
Glutamine (Gln, Q)
n = 8 (2.31%)
Histidine (His, H)
n = 5 (1.44%)
Lysine (Lys, K)
n = 15 (4.32%)
Arginine (Arg, R)
n = 3 (0.86%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 22 30 5 10 33 4 6 8 0 2 2 3 1 6 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 1 9 11 1 1 2 12 0 2 8 11 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 21 0 2 9 15 0 0 3 1 8 0 0 3 10 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 5 0 0 2 15 0 0 0 3 0 0 0 0 1 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
52 89 143 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 108 58 151
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 113 183 42
ND3 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (4.32%)
Alanine (Ala, A)
n = 22 (6.34%)
Serine (Ser, S)
n = 29 (8.36%)
Threonine (Thr, T)
n = 39 (11.24%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 8 (2.31%)
Leucine (Leu, L)
n = 58 (16.71%)
Isoleucine (Ile, I)
n = 40 (11.53%)
Methionine (Met, M)
n = 33 (9.51%)
Proline (Pro, P)
n = 21 (6.05%)
Phenylalanine (Phe, F)
n = 12 (3.46%)
Tyrosine (Tyr, Y)
n = 9 (2.59%)
Tryptophan (Trp, W)
n = 10 (2.88%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 5 (1.44%)
Asparagine (Asn, N)
n = 13 (3.75%)
Glutamine (Gln, Q)
n = 8 (2.31%)
Histidine (His, H)
n = 5 (1.44%)
Lysine (Lys, K)
n = 15 (4.32%)
Arginine (Arg, R)
n = 3 (0.86%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 22 30 5 10 33 4 6 8 0 2 2 3 1 6 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 1 9 11 1 1 2 12 0 2 8 11 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 21 0 2 9 15 0 0 3 1 8 0 0 3 10 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 5 0 0 2 15 0 0 0 3 0 0 0 0 1 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
52 89 143 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 108 58 151
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 113 183 42
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (3.71%)
Alanine (Ala, A)
n = 32 (6.99%)
Serine (Ser, S)
n = 41 (8.95%)
Threonine (Thr, T)
n = 41 (8.95%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 13 (2.84%)
Leucine (Leu, L)
n = 91 (19.87%)
Isoleucine (Ile, I)
n = 42 (9.17%)
Methionine (Met, M)
n = 32 (6.99%)
Proline (Pro, P)
n = 22 (4.8%)
Phenylalanine (Phe, F)
n = 17 (3.71%)
Tyrosine (Tyr, Y)
n = 18 (3.93%)
Tryptophan (Trp, W)
n = 13 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 8 (1.75%)
Asparagine (Asn, N)
n = 22 (4.8%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 8 (1.75%)
Lysine (Lys, K)
n = 15 (3.28%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
24 18 27 9 12 47 6 15 9 2 1 3 8 1 7 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 2 6 11 15 0 3 3 8 3 4 8 10 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 24 1 6 8 13 3 2 9 9 9 1 2 9 13 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 7 1 1 2 14 1 0 2 6 2 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
73 125 163 98
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
54 125 85 195
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 128 215 88
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 6 (6.12%)
Serine (Ser, S)
n = 9 (9.18%)
Threonine (Thr, T)
n = 4 (4.08%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 6 (6.12%)
Leucine (Leu, L)
n = 22 (22.45%)
Isoleucine (Ile, I)
n = 10 (10.2%)
Methionine (Met, M)
n = 9 (9.18%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 5 (5.1%)
Tyrosine (Tyr, Y)
n = 4 (4.08%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 7 (7.14%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 6 5 0 2 12 3 5 2 0 1 0 4 1 1 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 3 1 3 2 0 1 2 1 0 0 1 0 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 1 0 1 7 0 0 1 0 2 2 0 0 5 2 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 0 1 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
19 23 31 26
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 19 19 52
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 35 36 20
ND5 (size: 1821 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 29 (4.79%)
Alanine (Ala, A)
n = 39 (6.44%)
Serine (Ser, S)
n = 51 (8.42%)
Threonine (Thr, T)
n = 50 (8.25%)
Cysteine (Cys, C)
n = 4 (0.66%)
Valine (Val, V)
n = 24 (3.96%)
Leucine (Leu, L)
n = 84 (13.86%)
Isoleucine (Ile, I)
n = 55 (9.08%)
Methionine (Met, M)
n = 45 (7.43%)
Proline (Pro, P)
n = 23 (3.8%)
Phenylalanine (Phe, F)
n = 44 (7.26%)
Tyrosine (Tyr, Y)
n = 21 (3.47%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 11 (1.82%)
Glutamic acid (Glu, E)
n = 11 (1.82%)
Asparagine (Asn, N)
n = 38 (6.27%)
Glutamine (Gln, Q)
n = 19 (3.14%)
Histidine (His, H)
n = 12 (1.98%)
Lysine (Lys, K)
n = 24 (3.96%)
Arginine (Arg, R)
n = 9 (1.49%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
25 30 35 10 16 43 3 11 18 1 3 3 16 2 7 36
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
10 2 2 9 16 12 2 2 7 16 4 5 8 9 1 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 19 1 8 15 16 1 2 9 11 10 1 0 16 22 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 10 1 1 10 20 4 1 4 4 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
114 135 223 132
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
65 152 137 250
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
31 218 241 114
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (13.71%)
Alanine (Ala, A)
n = 12 (6.86%)
Serine (Ser, S)
n = 15 (8.57%)
Threonine (Thr, T)
n = 10 (5.71%)
Cysteine (Cys, C)
n = 2 (1.14%)
Valine (Val, V)
n = 20 (11.43%)
Leucine (Leu, L)
n = 19 (10.86%)
Isoleucine (Ile, I)
n = 14 (8.0%)
Methionine (Met, M)
n = 9 (5.14%)
Proline (Pro, P)
n = 4 (2.29%)
Phenylalanine (Phe, F)
n = 13 (7.43%)
Tyrosine (Tyr, Y)
n = 9 (5.14%)
Tryptophan (Trp, W)
n = 4 (2.29%)
Aspartic acid (Asp, D)
n = 5 (2.86%)
Glutamic acid (Glu, E)
n = 9 (5.14%)
Asparagine (Asn, N)
n = 3 (1.71%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 2 (1.14%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 0 4 3 0 1 0 10 0 0 10 0 3 7 11 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 2 0 9 0 1 2 15 0 3 6 3 1 0 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 0 2 6 0 1 1 6 1 8 1 3 5 3 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 9 4 1 0 2 1 0 0 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 9 45 52
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 34 29 75
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
42 7 25 102
Total protein-coding genes (size: 11409 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 216 (5.68%)
Alanine (Ala, A)
n = 254 (6.68%)
Serine (Ser, S)
n = 297 (7.81%)
Threonine (Thr, T)
n = 305 (8.02%)
Cysteine (Cys, C)
n = 23 (0.61%)
Valine (Val, V)
n = 181 (4.76%)
Leucine (Leu, L)
n = 587 (15.44%)
Isoleucine (Ile, I)
n = 336 (8.84%)
Methionine (Met, M)
n = 253 (6.66%)
Proline (Pro, P)
n = 194 (5.1%)
Phenylalanine (Phe, F)
n = 232 (6.1%)
Tyrosine (Tyr, Y)
n = 134 (3.53%)
Tryptophan (Trp, W)
n = 104 (2.74%)
Aspartic acid (Asp, D)
n = 70 (1.84%)
Glutamic acid (Glu, E)
n = 97 (2.55%)
Asparagine (Asn, N)
n = 157 (4.13%)
Glutamine (Gln, Q)
n = 89 (2.34%)
Histidine (His, H)
n = 94 (2.47%)
Lysine (Lys, K)
n = 103 (2.71%)
Arginine (Arg, R)
n = 65 (1.71%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
176 160 197 68 81 287 34 102 81 8 35 26 95 25 90 141
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
56 9 14 59 102 83 10 40 48 107 21 41 59 88 6 56
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
91 148 10 50 68 113 9 15 42 68 66 11 14 62 95 27
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
67 78 19 25 45 91 12 6 12 41 6 1 0 8 1 93
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
818 912 1212 857
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
466 993 753 1587
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
242 1117 1613 827

Failed to understand id: ?term=("Herpestes javanicus"[Organism]) AND (refseq[filter] AND mitochondrion[filter])


Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.