Viewing data for Panthera tigris


Scientific name Panthera tigris
Common name Tiger
Maximum lifespan 26.30 years (Panthera tigris@AnAge)

Total mtDNA (size: 16990 bases) GC AT G C A T
Base content (bases) 6991 9999 4513 2478 4581 5418
Base content per 1 kb (bases) 411 589 266 146 270 319
Base content (%) 41.1% 58.9%
Total protein-coding genes (size: 11339 bases) GC AT G C A T
Base content (bases) 4757 6582 3201 1556 3139 3443
Base content per 1 kb (bases) 420 580 282 137 277 304
Base content (%) 42.0% 58.0%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1515 bases) GC AT G C A T
Base content (bases) 548 967 312 236 431 536
Base content per 1 kb (bases) 362 638 206 156 284 354
Base content (%) 36.2% 63.8%
Total rRNA-coding genes (size: 2535 bases) GC AT G C A T
Base content (bases) 1028 1507 569 459 584 923
Base content per 1 kb (bases) 406 594 224 181 230 364
Base content (%) 40.6% 59.4%
12S rRNA gene (size: 960 bases) GC AT G C A T
Base content (bases) 402 558 228 174 214 344
Base content per 1 kb (bases) 419 581 238 181 223 358
Base content (%) 41.9% 58.1%
16S rRNA gene (size: 1575 bases) GC AT G C A T
Base content (bases) 626 949 341 285 370 579
Base content per 1 kb (bases) 397 603 217 181 235 368
Base content (%) 39.7% 60.3%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 277 404 191 86 207 197
Base content per 1 kb (bases) 407 593 280 126 304 289
Base content (%) 40.7% 59.3%
ATP8 (size: 204 bases) GC AT G C A T
Base content (bases) 71 133 52 19 54 79
Base content per 1 kb (bases) 348 652 255 93 265 387
Base content (%) 34.8% 65.2%
COX1 (size: 1545 bases) GC AT G C A T
Base content (bases) 664 881 369 295 479 402
Base content per 1 kb (bases) 430 570 239 191 310 260
Base content (%) 43.0% 57.0%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 288 396 178 110 188 208
Base content per 1 kb (bases) 421 579 260 161 275 304
Base content (%) 42.1% 57.9%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 353 431 223 130 221 210
Base content per 1 kb (bases) 450 550 284 166 282 268
Base content (%) 45.0% 55.0%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 510 630 346 164 312 318
Base content per 1 kb (bases) 447 553 304 144 274 279
Base content (%) 44.7% 55.3%
ND1 (size: 956 bases) GC AT G C A T
Base content (bases) 402 554 289 113 259 295
Base content per 1 kb (bases) 421 579 302 118 271 309
Base content (%) 42.1% 57.9%
ND2 (size: 1042 bases) GC AT G C A T
Base content (bases) 407 635 304 103 263 372
Base content per 1 kb (bases) 391 609 292 99 252 357
Base content (%) 39.1% 60.9%
ND3 (size: 347 bases) GC AT G C A T
Base content (bases) 151 196 108 43 90 106
Base content per 1 kb (bases) 435 565 311 124 259 305
Base content (%) 43.5% 56.5%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 564 814 398 166 379 435
Base content per 1 kb (bases) 409 591 289 120 275 316
Base content (%) 40.9% 59.1%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 120 177 77 43 92 85
Base content per 1 kb (bases) 404 596 259 145 310 286
Base content (%) 40.4% 59.6%
ND5 (size: 1821 bases) GC AT G C A T
Base content (bases) 754 1067 526 228 506 561
Base content per 1 kb (bases) 414 586 289 125 278 308
Base content (%) 41.4% 58.6%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 218 310 156 62 109 201
Base content per 1 kb (bases) 413 587 295 117 206 381
Base content (%) 41.3% 58.7%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.87%)
Alanine (Ala, A)
n = 17 (7.52%)
Serine (Ser, S)
n = 12 (5.31%)
Threonine (Thr, T)
n = 24 (10.62%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 14 (6.19%)
Leucine (Leu, L)
n = 44 (19.47%)
Isoleucine (Ile, I)
n = 22 (9.73%)
Methionine (Met, M)
n = 11 (4.87%)
Proline (Pro, P)
n = 14 (6.19%)
Phenylalanine (Phe, F)
n = 12 (5.31%)
Tyrosine (Tyr, Y)
n = 3 (1.33%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 11 (4.87%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 7 (3.1%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 4 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 12 7 5 5 16 5 11 8 1 4 2 6 2 8 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 6 9 2 0 1 3 6 1 5 5 4 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 7 0 2 1 4 1 1 3 2 1 1 2 7 4 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 3 0 1 0 3 1 1 1 2 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
46 65 76 40
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
22 63 39 103
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 63 82 64
ATP8 (size: 204 bases)
Amino acid sequence: MPQLDTSTWFITIISMIMTLFVMFQLKISKHLYPSSPEPKSTAALKQPSPWEKKWTKIYSPLLLPQQ*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 2 (2.99%)
Serine (Ser, S)
n = 8 (11.94%)
Threonine (Thr, T)
n = 6 (8.96%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.49%)
Leucine (Leu, L)
n = 8 (11.94%)
Isoleucine (Ile, I)
n = 6 (8.96%)
Methionine (Met, M)
n = 4 (5.97%)
Proline (Pro, P)
n = 8 (11.94%)
Phenylalanine (Phe, F)
n = 3 (4.48%)
Tyrosine (Tyr, Y)
n = 2 (2.99%)
Tryptophan (Trp, W)
n = 3 (4.48%)
Aspartic acid (Asp, D)
n = 1 (1.49%)
Glutamic acid (Glu, E)
n = 2 (2.99%)
Asparagine (Asn, N)
n = 0 (0%)
Glutamine (Gln, Q)
n = 5 (7.46%)
Histidine (His, H)
n = 1 (1.49%)
Lysine (Lys, K)
n = 7 (10.45%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 3 2 1 0 2 2 3 3 2 1 0 0 0 2 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 1 0 1 0 0 0 0 0 1 3 3 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 3 1 1 0 5 0 1 1 1 1 0 0 0 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 0 0 1 7 0 0 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
6 19 25 18
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 22 19 22
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 11 35 14
COX1 (size: 1545 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.14%)
Alanine (Ala, A)
n = 41 (7.98%)
Serine (Ser, S)
n = 30 (5.84%)
Threonine (Thr, T)
n = 39 (7.59%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 39 (7.59%)
Leucine (Leu, L)
n = 61 (11.87%)
Isoleucine (Ile, I)
n = 33 (6.42%)
Methionine (Met, M)
n = 34 (6.61%)
Proline (Pro, P)
n = 28 (5.45%)
Phenylalanine (Phe, F)
n = 42 (8.17%)
Tyrosine (Tyr, Y)
n = 19 (3.7%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 15 (2.92%)
Glutamic acid (Glu, E)
n = 10 (1.95%)
Asparagine (Asn, N)
n = 17 (3.31%)
Glutamine (Gln, Q)
n = 6 (1.17%)
Histidine (His, H)
n = 18 (3.5%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 11 21 9 5 23 9 10 5 1 7 8 17 7 23 19
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
13 1 0 12 14 14 1 6 13 15 13 10 9 6 3 16
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 14 3 5 6 14 2 1 2 8 11 7 5 11 6 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 9 1 10 5 7 2 1 1 6 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
152 106 135 122
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 135 95 209
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
67 128 172 148
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.96%)
Alanine (Ala, A)
n = 8 (3.52%)
Serine (Ser, S)
n = 20 (8.81%)
Threonine (Thr, T)
n = 18 (7.93%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 12 (5.29%)
Leucine (Leu, L)
n = 34 (14.98%)
Isoleucine (Ile, I)
n = 19 (8.37%)
Methionine (Met, M)
n = 14 (6.17%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 7 (3.08%)
Tyrosine (Tyr, Y)
n = 11 (4.85%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 10 (4.41%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 5 (2.2%)
Glutamine (Gln, Q)
n = 7 (3.08%)
Histidine (His, H)
n = 7 (3.08%)
Lysine (Lys, K)
n = 5 (2.2%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 8 10 3 5 11 6 8 5 2 1 4 5 2 2 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 2 2 4 2 0 2 4 2 1 2 6 4 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 7 1 2 6 6 1 2 3 6 5 0 1 3 2 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 8 7 5 5 3 2 0 1 4 1 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
54 58 66 50
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
27 54 61 86
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
29 66 81 52
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 15 (5.77%)
Serine (Ser, S)
n = 22 (8.46%)
Threonine (Thr, T)
n = 22 (8.46%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 14 (5.38%)
Leucine (Leu, L)
n = 33 (12.69%)
Isoleucine (Ile, I)
n = 16 (6.15%)
Methionine (Met, M)
n = 11 (4.23%)
Proline (Pro, P)
n = 11 (4.23%)
Phenylalanine (Phe, F)
n = 22 (8.46%)
Tyrosine (Tyr, Y)
n = 13 (5.0%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 6 (2.31%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 8 8 3 6 15 3 3 7 0 5 2 4 3 7 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 1 4 8 3 0 2 4 11 3 0 5 5 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 9 0 3 5 6 3 0 5 8 5 4 3 3 3 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 6 2 0 3 3 0 0 1 3 1 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
60 66 63 72
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 65 56 96
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
26 92 91 52
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (6.86%)
Alanine (Ala, A)
n = 24 (6.33%)
Serine (Ser, S)
n = 26 (6.86%)
Threonine (Thr, T)
n = 24 (6.33%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 20 (5.28%)
Leucine (Leu, L)
n = 58 (15.3%)
Isoleucine (Ile, I)
n = 40 (10.55%)
Methionine (Met, M)
n = 12 (3.17%)
Proline (Pro, P)
n = 22 (5.8%)
Phenylalanine (Phe, F)
n = 26 (6.86%)
Tyrosine (Tyr, Y)
n = 15 (3.96%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 12 (3.17%)
Glutamic acid (Glu, E)
n = 5 (1.32%)
Asparagine (Asn, N)
n = 15 (3.96%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 13 (3.43%)
Lysine (Lys, K)
n = 10 (2.64%)
Arginine (Arg, R)
n = 9 (2.37%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 24 7 5 12 25 2 13 6 0 2 7 7 4 9 17
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 3 3 13 8 0 2 8 11 5 4 10 6 2 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 10 1 2 8 15 0 0 1 4 11 2 1 6 9 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 4 1 2 10 9 1 0 2 7 0 1 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
87 94 103 96
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 95 76 156
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 157 139 60
ND1 (size: 956 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.79%)
Alanine (Ala, A)
n = 30 (9.46%)
Serine (Ser, S)
n = 18 (5.68%)
Threonine (Thr, T)
n = 26 (8.2%)
Cysteine (Cys, C)
n = 1 (0.32%)
Valine (Val, V)
n = 14 (4.42%)
Leucine (Leu, L)
n = 53 (16.72%)
Isoleucine (Ile, I)
n = 30 (9.46%)
Methionine (Met, M)
n = 18 (5.68%)
Proline (Pro, P)
n = 22 (6.94%)
Phenylalanine (Phe, F)
n = 21 (6.62%)
Tyrosine (Tyr, Y)
n = 13 (4.1%)
Tryptophan (Trp, W)
n = 9 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.95%)
Glutamic acid (Glu, E)
n = 11 (3.47%)
Asparagine (Asn, N)
n = 13 (4.1%)
Glutamine (Gln, Q)
n = 6 (1.89%)
Histidine (His, H)
n = 3 (0.95%)
Lysine (Lys, K)
n = 7 (2.21%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 18 14 3 12 29 2 7 5 1 3 3 7 1 7 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 8 11 11 0 0 3 9 0 3 10 9 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 14 0 1 8 7 0 0 2 6 7 3 0 4 9 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 11 0 1 2 7 0 2 0 6 0 0 0 0 0 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 85 96 67
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 94 56 136
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 110 142 55
ND2 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (4.34%)
Alanine (Ala, A)
n = 19 (5.49%)
Serine (Ser, S)
n = 24 (6.94%)
Threonine (Thr, T)
n = 38 (10.98%)
Cysteine (Cys, C)
n = 2 (0.58%)
Valine (Val, V)
n = 10 (2.89%)
Leucine (Leu, L)
n = 56 (16.18%)
Isoleucine (Ile, I)
n = 37 (10.69%)
Methionine (Met, M)
n = 41 (11.85%)
Proline (Pro, P)
n = 21 (6.07%)
Phenylalanine (Phe, F)
n = 10 (2.89%)
Tyrosine (Tyr, Y)
n = 10 (2.89%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 14 (4.05%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 4 (1.16%)
Lysine (Lys, K)
n = 17 (4.91%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 24 35 5 11 22 9 8 8 1 3 2 4 1 1 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 1 2 8 9 0 1 6 7 1 1 13 7 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 18 1 4 7 12 0 0 1 4 6 0 1 1 13 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 0 1 1 17 0 0 0 3 1 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
50 85 148 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 101 60 154
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 118 164 44
ND3 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (4.34%)
Alanine (Ala, A)
n = 19 (5.49%)
Serine (Ser, S)
n = 24 (6.94%)
Threonine (Thr, T)
n = 38 (10.98%)
Cysteine (Cys, C)
n = 2 (0.58%)
Valine (Val, V)
n = 10 (2.89%)
Leucine (Leu, L)
n = 56 (16.18%)
Isoleucine (Ile, I)
n = 37 (10.69%)
Methionine (Met, M)
n = 41 (11.85%)
Proline (Pro, P)
n = 21 (6.07%)
Phenylalanine (Phe, F)
n = 10 (2.89%)
Tyrosine (Tyr, Y)
n = 10 (2.89%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 14 (4.05%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 4 (1.16%)
Lysine (Lys, K)
n = 17 (4.91%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 24 35 5 11 22 9 8 8 1 3 2 4 1 1 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 1 2 8 9 0 1 6 7 1 1 13 7 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 18 1 4 7 12 0 0 1 4 6 0 1 1 13 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 0 1 1 17 0 0 0 3 1 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
50 85 148 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 101 60 154
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 118 164 44
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (3.71%)
Alanine (Ala, A)
n = 35 (7.64%)
Serine (Ser, S)
n = 37 (8.08%)
Threonine (Thr, T)
n = 41 (8.95%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 17 (3.71%)
Leucine (Leu, L)
n = 90 (19.65%)
Isoleucine (Ile, I)
n = 44 (9.61%)
Methionine (Met, M)
n = 31 (6.77%)
Proline (Pro, P)
n = 21 (4.59%)
Phenylalanine (Phe, F)
n = 17 (3.71%)
Tyrosine (Tyr, Y)
n = 18 (3.93%)
Tryptophan (Trp, W)
n = 13 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 8 (1.75%)
Asparagine (Asn, N)
n = 21 (4.59%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 9 (1.97%)
Lysine (Lys, K)
n = 13 (2.84%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
25 19 23 8 20 41 12 8 10 1 1 3 10 3 8 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 1 2 10 14 11 0 2 7 7 1 6 9 6 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 24 0 5 6 15 0 3 8 6 12 2 1 7 14 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 5 3 0 3 12 1 0 2 8 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
80 132 161 86
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
54 123 83 199
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
32 143 191 93
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 7 (7.14%)
Serine (Ser, S)
n = 9 (9.18%)
Threonine (Thr, T)
n = 5 (5.1%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 8 (8.16%)
Leucine (Leu, L)
n = 21 (21.43%)
Isoleucine (Ile, I)
n = 5 (5.1%)
Methionine (Met, M)
n = 12 (12.24%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 5 (5.1%)
Tyrosine (Tyr, Y)
n = 4 (4.08%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 6 (6.12%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 3 6 1 2 11 3 2 2 0 2 1 5 0 3 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 3 2 1 4 0 1 2 1 0 0 1 0 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 2 0 0 6 2 0 0 1 3 1 0 2 2 4 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 1 1 0 1 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
22 23 29 25
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 21 18 51
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 33 38 16
ND5 (size: 1821 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (4.62%)
Alanine (Ala, A)
n = 42 (6.93%)
Serine (Ser, S)
n = 53 (8.75%)
Threonine (Thr, T)
n = 49 (8.09%)
Cysteine (Cys, C)
n = 6 (0.99%)
Valine (Val, V)
n = 18 (2.97%)
Leucine (Leu, L)
n = 93 (15.35%)
Isoleucine (Ile, I)
n = 57 (9.41%)
Methionine (Met, M)
n = 41 (6.77%)
Proline (Pro, P)
n = 26 (4.29%)
Phenylalanine (Phe, F)
n = 42 (6.93%)
Tyrosine (Tyr, Y)
n = 19 (3.14%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 9 (1.49%)
Glutamic acid (Glu, E)
n = 12 (1.98%)
Asparagine (Asn, N)
n = 31 (5.12%)
Glutamine (Gln, Q)
n = 21 (3.47%)
Histidine (His, H)
n = 15 (2.48%)
Lysine (Lys, K)
n = 24 (3.96%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 37 33 12 24 31 9 14 18 3 5 3 8 2 19 23
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 2 4 4 24 13 1 3 7 15 3 2 9 15 0 13
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 15 2 5 17 11 5 5 10 8 11 3 3 11 20 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 6 6 6 3 19 5 2 2 4 0 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
109 146 217 135
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
69 155 132 251
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
50 225 212 120
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (13.71%)
Alanine (Ala, A)
n = 12 (6.86%)
Serine (Ser, S)
n = 12 (6.86%)
Threonine (Thr, T)
n = 12 (6.86%)
Cysteine (Cys, C)
n = 2 (1.14%)
Valine (Val, V)
n = 22 (12.57%)
Leucine (Leu, L)
n = 19 (10.86%)
Isoleucine (Ile, I)
n = 13 (7.43%)
Methionine (Met, M)
n = 7 (4.0%)
Proline (Pro, P)
n = 4 (2.29%)
Phenylalanine (Phe, F)
n = 13 (7.43%)
Tyrosine (Tyr, Y)
n = 9 (5.14%)
Tryptophan (Trp, W)
n = 4 (2.29%)
Aspartic acid (Asp, D)
n = 4 (2.29%)
Glutamic acid (Glu, E)
n = 9 (5.14%)
Asparagine (Asn, N)
n = 4 (2.29%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 4 (2.29%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 1 4 3 0 1 1 7 0 0 6 1 5 10 12 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 2 4 2 2 4 12 1 4 7 2 2 0 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 4 2 4 0 2 1 4 1 6 3 3 7 3 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 8 3 1 1 3 1 0 0 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 10 45 50
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 35 31 74
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
49 17 33 77
Total protein-coding genes (size: 11407 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 216 (5.69%)
Alanine (Ala, A)
n = 264 (6.95%)
Serine (Ser, S)
n = 279 (7.34%)
Threonine (Thr, T)
n = 314 (8.27%)
Cysteine (Cys, C)
n = 27 (0.71%)
Valine (Val, V)
n = 191 (5.03%)
Leucine (Leu, L)
n = 598 (15.74%)
Isoleucine (Ile, I)
n = 327 (8.61%)
Methionine (Met, M)
n = 242 (6.37%)
Proline (Pro, P)
n = 197 (5.19%)
Phenylalanine (Phe, F)
n = 227 (5.98%)
Tyrosine (Tyr, Y)
n = 139 (3.66%)
Tryptophan (Trp, W)
n = 104 (2.74%)
Aspartic acid (Asp, D)
n = 66 (1.74%)
Glutamic acid (Glu, E)
n = 95 (2.5%)
Asparagine (Asn, N)
n = 147 (3.87%)
Glutamine (Gln, Q)
n = 92 (2.42%)
Histidine (His, H)
n = 95 (2.5%)
Lysine (Lys, K)
n = 107 (2.82%)
Arginine (Arg, R)
n = 65 (1.71%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
155 172 175 63 106 240 66 96 80 12 40 36 80 35 102 125
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
67 8 19 61 112 84 7 32 58 91 35 38 86 65 8 75
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
96 132 11 34 74 101 13 18 39 64 75 25 27 58 89 28
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
67 65 30 29 37 92 15 7 11 44 3 1 0 7 0 79
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
832 924 1195 849
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
470 997 748 1585
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
354 1202 1432 812

F a i l e d  t o  u n d e r s t a n d  i d :  ? t e r m = ( " P a n t h e r a  t i g r i s " [ O r g a n i s m ] )  A N D  ( r e f s e q [ f i l t e r ]  A N D  m i t o c h o n d r i o n [ f i l t e r ] ) 



Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.