Viewing data for Sus scrofa


Scientific name Sus scrofa
Common name Wild boar
Maximum lifespan 27.00 years (Sus scrofa@AnAge)

Total mtDNA (size: 16613 bases) GC AT G C A T
Base content (bases) 6555 10058 4353 2202 4292 5766
Base content per 1 kb (bases) 395 605 262 133 258 347
Base content (%) 39.5% 60.5%
Total protein-coding genes (size: 11341 bases) GC AT G C A T
Base content (bases) 4504 6837 3151 1353 2979 3858
Base content per 1 kb (bases) 397 603 278 119 263 340
Base content (%) 39.7% 60.3%
D-loop (size: 1175 bases) GC AT G C A T
Base content (bases) 480 695 310 170 299 396
Base content per 1 kb (bases) 409 591 264 145 254 337
Base content (%) 40.9% 59.1%
Total tRNA-coding genes (size: 1507 bases) GC AT G C A T
Base content (bases) 560 947 322 238 415 532
Base content per 1 kb (bases) 372 628 214 158 275 353
Base content (%) 37.2% 62.8%
Total rRNA-coding genes (size: 2531 bases) GC AT G C A T
Base content (bases) 984 1547 554 430 589 958
Base content per 1 kb (bases) 389 611 219 170 233 379
Base content (%) 38.9% 61.1%
12S rRNA gene (size: 960 bases) GC AT G C A T
Base content (bases) 392 568 223 169 217 351
Base content per 1 kb (bases) 408 592 232 176 226 366
Base content (%) 40.8% 59.2%
16S rRNA gene (size: 1571 bases) GC AT G C A T
Base content (bases) 592 979 331 261 372 607
Base content per 1 kb (bases) 377 623 211 166 237 386
Base content (%) 37.7% 62.3%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 262 419 192 70 187 232
Base content per 1 kb (bases) 385 615 282 103 275 341
Base content (%) 38.5% 61.5%
ATP8 (size: 204 bases) GC AT G C A T
Base content (bases) 65 139 50 15 56 83
Base content per 1 kb (bases) 319 681 245 74 275 407
Base content (%) 31.9% 68.1%
COX1 (size: 1545 bases) GC AT G C A T
Base content (bases) 640 905 384 256 452 453
Base content per 1 kb (bases) 414 586 249 166 293 293
Base content (%) 41.4% 58.6%
COX2 (size: 688 bases) GC AT G C A T
Base content (bases) 267 421 177 90 183 238
Base content per 1 kb (bases) 388 612 257 131 266 346
Base content (%) 38.8% 61.2%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 345 439 227 118 209 230
Base content per 1 kb (bases) 440 560 290 151 267 293
Base content (%) 44.0% 56.0%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 477 663 329 148 303 360
Base content per 1 kb (bases) 418 582 289 130 266 316
Base content (%) 41.8% 58.2%
ND1 (size: 955 bases) GC AT G C A T
Base content (bases) 404 551 282 122 236 315
Base content per 1 kb (bases) 423 577 295 128 247 330
Base content (%) 42.3% 57.7%
ND2 (size: 1042 bases) GC AT G C A T
Base content (bases) 386 656 286 100 250 406
Base content per 1 kb (bases) 370 630 274 96 240 390
Base content (%) 37.0% 63.0%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 137 209 100 37 89 120
Base content per 1 kb (bases) 396 604 289 107 257 347
Base content (%) 39.6% 60.4%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 550 828 410 140 357 471
Base content per 1 kb (bases) 399 601 298 102 259 342
Base content (%) 39.9% 60.1%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 111 186 74 37 92 94
Base content per 1 kb (bases) 374 626 249 125 310 316
Base content (%) 37.4% 62.6%
ND5 (size: 1821 bases) GC AT G C A T
Base content (bases) 702 1119 512 190 476 643
Base content per 1 kb (bases) 386 614 281 104 261 353
Base content (%) 38.6% 61.4%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 181 347 143 38 110 237
Base content per 1 kb (bases) 343 657 271 72 208 449
Base content (%) 34.3% 65.7%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 10 (4.42%)
Alanine (Ala, A)
n = 17 (7.52%)
Serine (Ser, S)
n = 13 (5.75%)
Threonine (Thr, T)
n = 26 (11.5%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 8 (3.54%)
Leucine (Leu, L)
n = 40 (17.7%)
Isoleucine (Ile, I)
n = 27 (11.95%)
Methionine (Met, M)
n = 13 (5.75%)
Proline (Pro, P)
n = 12 (5.31%)
Phenylalanine (Phe, F)
n = 14 (6.19%)
Tyrosine (Tyr, Y)
n = 3 (1.33%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 11 (4.87%)
Glutamine (Gln, Q)
n = 10 (4.42%)
Histidine (His, H)
n = 6 (2.65%)
Lysine (Lys, K)
n = 5 (2.21%)
Arginine (Arg, R)
n = 4 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 10 11 2 4 22 4 8 10 0 0 1 6 1 8 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 4 8 5 0 1 3 4 2 2 5 5 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 16 1 2 1 6 1 0 3 2 1 0 0 3 8 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 3 0 0 1 5 0 0 2 2 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
39 64 85 39
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
20 65 40 102
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 63 107 46
ATP8 (size: 204 bases)
Amino acid sequence: MPQLDTSTWFITITSMIMTLFILFQLKISNYSYPASPESIELKTQKHSTPWEMKWTKIYLPLLLPPR*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 1 (1.49%)
Serine (Ser, S)
n = 7 (10.45%)
Threonine (Thr, T)
n = 8 (11.94%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 9 (13.43%)
Isoleucine (Ile, I)
n = 7 (10.45%)
Methionine (Met, M)
n = 4 (5.97%)
Proline (Pro, P)
n = 7 (10.45%)
Phenylalanine (Phe, F)
n = 3 (4.48%)
Tyrosine (Tyr, Y)
n = 3 (4.48%)
Tryptophan (Trp, W)
n = 3 (4.48%)
Aspartic acid (Asp, D)
n = 1 (1.49%)
Glutamic acid (Glu, E)
n = 3 (4.48%)
Asparagine (Asn, N)
n = 1 (1.49%)
Glutamine (Gln, Q)
n = 3 (4.48%)
Histidine (His, H)
n = 1 (1.49%)
Lysine (Lys, K)
n = 5 (7.46%)
Arginine (Arg, R)
n = 1 (1.49%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 2 3 1 1 2 0 3 3 0 0 0 0 0 1 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 1 0 0 0 0 0 2 1 4 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 5 1 0 1 4 0 0 2 1 2 0 2 0 1 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 3 0 1 0 5 0 0 0 1 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
5 16 27 20
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 21 18 23
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 13 38 13
COX1 (size: 1545 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.14%)
Alanine (Ala, A)
n = 42 (8.17%)
Serine (Ser, S)
n = 32 (6.23%)
Threonine (Thr, T)
n = 35 (6.81%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 37 (7.2%)
Leucine (Leu, L)
n = 60 (11.67%)
Isoleucine (Ile, I)
n = 39 (7.59%)
Methionine (Met, M)
n = 31 (6.03%)
Proline (Pro, P)
n = 28 (5.45%)
Phenylalanine (Phe, F)
n = 41 (7.98%)
Tyrosine (Tyr, Y)
n = 20 (3.89%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 14 (2.72%)
Glutamic acid (Glu, E)
n = 10 (1.95%)
Asparagine (Asn, N)
n = 18 (3.5%)
Glutamine (Gln, Q)
n = 7 (1.36%)
Histidine (His, H)
n = 18 (3.5%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 16 26 6 3 30 9 10 6 1 4 3 27 3 18 23
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 0 13 9 19 1 11 11 20 5 6 10 11 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 19 1 4 12 12 0 2 2 10 10 1 2 7 11 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 10 0 8 6 9 0 2 2 4 0 0 0 1 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
150 109 136 120
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 133 97 208
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
29 142 220 124
COX2 (size: 688 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.95%)
Alanine (Ala, A)
n = 8 (3.51%)
Serine (Ser, S)
n = 19 (8.33%)
Threonine (Thr, T)
n = 21 (9.21%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 12 (5.26%)
Leucine (Leu, L)
n = 33 (14.47%)
Isoleucine (Ile, I)
n = 18 (7.89%)
Methionine (Met, M)
n = 16 (7.02%)
Proline (Pro, P)
n = 13 (5.7%)
Phenylalanine (Phe, F)
n = 7 (3.07%)
Tyrosine (Tyr, Y)
n = 11 (4.82%)
Tryptophan (Trp, W)
n = 5 (2.19%)
Aspartic acid (Asp, D)
n = 11 (4.82%)
Glutamic acid (Glu, E)
n = 14 (6.14%)
Asparagine (Asn, N)
n = 5 (2.19%)
Glutamine (Gln, Q)
n = 6 (2.63%)
Histidine (His, H)
n = 7 (3.07%)
Lysine (Lys, K)
n = 6 (2.63%)
Arginine (Arg, R)
n = 6 (2.63%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 10 13 7 4 10 2 10 5 1 2 2 7 1 2 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 1 3 5 0 0 2 2 5 0 3 4 6 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 14 0 2 3 10 0 0 4 6 5 1 0 2 3 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 13 1 4 7 5 1 0 0 6 0 0 0 0 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
54 55 70 50
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 57 60 86
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 65 108 46
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 16 (6.15%)
Serine (Ser, S)
n = 22 (8.46%)
Threonine (Thr, T)
n = 22 (8.46%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 15 (5.77%)
Leucine (Leu, L)
n = 35 (13.46%)
Isoleucine (Ile, I)
n = 15 (5.77%)
Methionine (Met, M)
n = 9 (3.46%)
Proline (Pro, P)
n = 11 (4.23%)
Phenylalanine (Phe, F)
n = 21 (8.08%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 6 (2.31%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 7 8 3 5 17 1 7 7 0 3 1 9 2 6 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 2 2 7 7 0 2 5 10 3 0 3 8 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 9 0 3 7 8 0 0 4 3 8 1 2 1 5 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 6 2 1 3 3 0 0 0 5 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
63 66 59 73
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 67 56 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 94 115 40
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.33%)
Alanine (Ala, A)
n = 23 (6.07%)
Serine (Ser, S)
n = 24 (6.33%)
Threonine (Thr, T)
n = 25 (6.6%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 18 (4.75%)
Leucine (Leu, L)
n = 56 (14.78%)
Isoleucine (Ile, I)
n = 43 (11.35%)
Methionine (Met, M)
n = 17 (4.49%)
Proline (Pro, P)
n = 22 (5.8%)
Phenylalanine (Phe, F)
n = 27 (7.12%)
Tyrosine (Tyr, Y)
n = 14 (3.69%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 12 (3.17%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 17 (4.49%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 26 15 1 7 34 4 7 6 0 3 4 10 1 7 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 3 4 10 9 0 3 6 14 1 3 5 13 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 14 1 0 8 13 0 1 2 4 10 0 3 3 14 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 6 0 0 12 9 0 1 1 6 0 1 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
83 94 115 88
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 91 76 161
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 144 169 54
ND1 (size: 955 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.42%)
Alanine (Ala, A)
n = 29 (9.15%)
Serine (Ser, S)
n = 25 (7.89%)
Threonine (Thr, T)
n = 22 (6.94%)
Cysteine (Cys, C)
n = 1 (0.32%)
Valine (Val, V)
n = 15 (4.73%)
Leucine (Leu, L)
n = 52 (16.4%)
Isoleucine (Ile, I)
n = 29 (9.15%)
Methionine (Met, M)
n = 20 (6.31%)
Proline (Pro, P)
n = 21 (6.62%)
Phenylalanine (Phe, F)
n = 17 (5.36%)
Tyrosine (Tyr, Y)
n = 12 (3.79%)
Tryptophan (Trp, W)
n = 9 (2.84%)
Aspartic acid (Asp, D)
n = 4 (1.26%)
Glutamic acid (Glu, E)
n = 11 (3.47%)
Asparagine (Asn, N)
n = 11 (3.47%)
Glutamine (Gln, Q)
n = 6 (1.89%)
Histidine (His, H)
n = 5 (1.58%)
Lysine (Lys, K)
n = 7 (2.21%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 19 15 2 7 38 2 3 6 0 2 2 10 1 4 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 0 1 11 17 0 1 4 7 2 4 8 8 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 15 0 1 6 14 0 0 4 6 6 0 0 4 7 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 9 2 1 3 7 0 0 0 8 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
73 89 93 63
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 93 56 133
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 100 166 39
ND2 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 22 (6.36%)
Serine (Ser, S)
n = 28 (8.09%)
Threonine (Thr, T)
n = 37 (10.69%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 12 (3.47%)
Leucine (Leu, L)
n = 55 (15.9%)
Isoleucine (Ile, I)
n = 29 (8.38%)
Methionine (Met, M)
n = 44 (12.72%)
Proline (Pro, P)
n = 18 (5.2%)
Phenylalanine (Phe, F)
n = 11 (3.18%)
Tyrosine (Tyr, Y)
n = 9 (2.6%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 6 (1.73%)
Asparagine (Asn, N)
n = 17 (4.91%)
Glutamine (Gln, Q)
n = 12 (3.47%)
Histidine (His, H)
n = 6 (1.73%)
Lysine (Lys, K)
n = 13 (3.76%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 20 38 3 7 29 4 12 12 0 0 3 9 0 3 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 1 0 11 11 0 0 4 8 2 3 3 12 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 23 0 1 8 14 1 0 4 3 6 1 0 4 13 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 6 0 0 0 13 0 0 0 3 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
54 82 144 67
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 101 63 151
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 103 199 31
ND3 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 22 (6.36%)
Serine (Ser, S)
n = 28 (8.09%)
Threonine (Thr, T)
n = 37 (10.69%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 12 (3.47%)
Leucine (Leu, L)
n = 55 (15.9%)
Isoleucine (Ile, I)
n = 29 (8.38%)
Methionine (Met, M)
n = 44 (12.72%)
Proline (Pro, P)
n = 18 (5.2%)
Phenylalanine (Phe, F)
n = 11 (3.18%)
Tyrosine (Tyr, Y)
n = 9 (2.6%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 6 (1.73%)
Asparagine (Asn, N)
n = 17 (4.91%)
Glutamine (Gln, Q)
n = 12 (3.47%)
Histidine (His, H)
n = 6 (1.73%)
Lysine (Lys, K)
n = 13 (3.76%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 20 38 3 7 29 4 12 12 0 0 3 9 0 3 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 1 0 11 11 0 0 4 8 2 3 3 12 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 23 0 1 8 14 1 0 4 3 6 1 0 4 13 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 6 0 0 0 13 0 0 0 3 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
54 82 144 67
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 101 63 151
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 103 199 31
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.93%)
Alanine (Ala, A)
n = 32 (6.99%)
Serine (Ser, S)
n = 38 (8.3%)
Threonine (Thr, T)
n = 42 (9.17%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 13 (2.84%)
Leucine (Leu, L)
n = 89 (19.43%)
Isoleucine (Ile, I)
n = 44 (9.61%)
Methionine (Met, M)
n = 36 (7.86%)
Proline (Pro, P)
n = 19 (4.15%)
Phenylalanine (Phe, F)
n = 18 (3.93%)
Tyrosine (Tyr, Y)
n = 16 (3.49%)
Tryptophan (Trp, W)
n = 13 (2.84%)
Aspartic acid (Asp, D)
n = 2 (0.44%)
Glutamic acid (Glu, E)
n = 9 (1.97%)
Asparagine (Asn, N)
n = 23 (5.02%)
Glutamine (Gln, Q)
n = 9 (1.97%)
Histidine (His, H)
n = 13 (2.84%)
Lysine (Lys, K)
n = 12 (2.62%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 26 33 8 16 49 8 8 9 0 2 0 11 0 4 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 3 2 16 14 0 1 5 11 1 3 7 9 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 23 0 5 12 11 0 3 7 8 8 0 0 5 18 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 9 0 0 2 12 0 1 1 8 0 0 0 0 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 132 167 86
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
54 121 84 200
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 157 220 70
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 9 (9.18%)
Serine (Ser, S)
n = 7 (7.14%)
Threonine (Thr, T)
n = 5 (5.1%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 6 (6.12%)
Leucine (Leu, L)
n = 22 (22.45%)
Isoleucine (Ile, I)
n = 8 (8.16%)
Methionine (Met, M)
n = 10 (10.2%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 4 (4.08%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 6 (6.12%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 4 9 3 0 12 1 6 2 0 0 1 3 2 1 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 3 2 2 4 1 1 1 1 1 0 1 1 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 2 0 2 1 3 1 0 0 2 2 0 0 0 6 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 0 1 0 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
22 23 29 25
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
8 23 18 50
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 28 47 17
ND5 (size: 1821 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (4.62%)
Alanine (Ala, A)
n = 38 (6.27%)
Serine (Ser, S)
n = 47 (7.76%)
Threonine (Thr, T)
n = 52 (8.58%)
Cysteine (Cys, C)
n = 5 (0.83%)
Valine (Val, V)
n = 23 (3.8%)
Leucine (Leu, L)
n = 85 (14.03%)
Isoleucine (Ile, I)
n = 57 (9.41%)
Methionine (Met, M)
n = 46 (7.59%)
Proline (Pro, P)
n = 28 (4.62%)
Phenylalanine (Phe, F)
n = 42 (6.93%)
Tyrosine (Tyr, Y)
n = 24 (3.96%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 10 (1.65%)
Glutamic acid (Glu, E)
n = 13 (2.15%)
Asparagine (Asn, N)
n = 34 (5.61%)
Glutamine (Gln, Q)
n = 16 (2.64%)
Histidine (His, H)
n = 14 (2.31%)
Lysine (Lys, K)
n = 23 (3.8%)
Arginine (Arg, R)
n = 9 (1.49%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 35 44 7 10 50 4 12 15 1 1 4 17 1 15 27
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 4 7 11 20 0 0 9 17 2 2 13 13 0 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 28 0 4 14 19 0 1 9 5 19 0 2 8 26 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 11 2 2 8 23 0 1 4 4 0 0 0 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
112 138 222 135
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
64 155 135 253
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 219 286 88
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (14.86%)
Alanine (Ala, A)
n = 8 (4.57%)
Serine (Ser, S)
n = 12 (6.86%)
Threonine (Thr, T)
n = 10 (5.71%)
Cysteine (Cys, C)
n = 2 (1.14%)
Valine (Val, V)
n = 20 (11.43%)
Leucine (Leu, L)
n = 16 (9.14%)
Isoleucine (Ile, I)
n = 16 (9.14%)
Methionine (Met, M)
n = 11 (6.29%)
Proline (Pro, P)
n = 3 (1.71%)
Phenylalanine (Phe, F)
n = 15 (8.57%)
Tyrosine (Tyr, Y)
n = 10 (5.71%)
Tryptophan (Trp, W)
n = 4 (2.29%)
Aspartic acid (Asp, D)
n = 3 (1.71%)
Glutamic acid (Glu, E)
n = 10 (5.71%)
Asparagine (Asn, N)
n = 4 (2.29%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 4 (2.29%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 1 2 3 0 0 0 6 0 0 14 0 4 2 15 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 2 0 5 0 2 1 14 0 4 8 2 1 0 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 1 1 6 0 1 1 4 0 10 0 0 7 4 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 4 6 3 0 0 4 1 0 0 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 7 49 53
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 29 32 78
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
39 2 29 106
Total protein-coding genes (size: 11409 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 217 (5.71%)
Alanine (Ala, A)
n = 257 (6.76%)
Serine (Ser, S)
n = 281 (7.39%)
Threonine (Thr, T)
n = 314 (8.26%)
Cysteine (Cys, C)
n = 25 (0.66%)
Valine (Val, V)
n = 182 (4.79%)
Leucine (Leu, L)
n = 579 (15.24%)
Isoleucine (Ile, I)
n = 337 (8.87%)
Methionine (Met, M)
n = 263 (6.92%)
Proline (Pro, P)
n = 190 (5.0%)
Phenylalanine (Phe, F)
n = 228 (6.0%)
Tyrosine (Tyr, Y)
n = 140 (3.68%)
Tryptophan (Trp, W)
n = 104 (2.74%)
Aspartic acid (Asp, D)
n = 65 (1.71%)
Glutamic acid (Glu, E)
n = 101 (2.66%)
Asparagine (Asn, N)
n = 158 (4.16%)
Glutamine (Gln, Q)
n = 87 (2.29%)
Histidine (His, H)
n = 101 (2.66%)
Lysine (Lys, K)
n = 100 (2.63%)
Arginine (Arg, R)
n = 65 (1.71%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
158 179 223 52 69 309 39 92 84 3 31 21 116 14 88 140
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
40 8 17 43 93 118 3 36 51 103 27 30 64 93 3 50
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
83 176 5 30 75 118 4 11 43 62 78 4 18 43 115 22
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
79 88 13 22 43 95 5 6 11 48 0 1 0 6 0 100
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
822 912 1227 840
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
466 988 758 1589
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
178 1161 1770 692

Failed to understand id: ?term=("Sus scrofa"[Organism]) AND (refseq[filter] AND mitochondrion[filter])


Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.