Viewing data for Branta bernicla


Scientific name Branta bernicla
Common name Brent goose
Maximum lifespan 28.80 years (Branta bernicla@AnAge)

Total mtDNA (size: 17524 bases) GC AT G C A T
Base content (bases) 8314 9210 5625 2689 3979 5231
Base content per 1 kb (bases) 474 526 321 153 227 299
Base content (%) 47.4% 52.6%
Total protein-coding genes (size: 12164 bases) GC AT G C A T
Base content (bases) 5865 6299 4145 1720 2779 3520
Base content per 1 kb (bases) 482 518 341 141 228 289
Base content (%) 48.2% 51.8%
D-loop (size: 1188 bases) GC AT G C A T
Base content (bases) 560 628 383 177 293 335
Base content per 1 kb (bases) 471 529 322 149 247 282
Base content (%) 47.1% 52.9%
Total tRNA-coding genes (size: 1540 bases) GC AT G C A T
Base content (bases) 655 885 389 266 379 506
Base content per 1 kb (bases) 425 575 253 173 246 329
Base content (%) 42.5% 57.5%
Total rRNA-coding genes (size: 2593 bases) GC AT G C A T
Base content (bases) 1213 1380 686 527 518 862
Base content per 1 kb (bases) 468 532 265 203 200 332
Base content (%) 46.8% 53.2%
12S rRNA gene (size: 988 bases) GC AT G C A T
Base content (bases) 477 511 273 204 196 315
Base content per 1 kb (bases) 483 517 276 206 198 319
Base content (%) 48.3% 51.7%
16S rRNA gene (size: 1605 bases) GC AT G C A T
Base content (bases) 736 869 413 323 322 547
Base content per 1 kb (bases) 459 541 257 201 201 341
Base content (%) 45.9% 54.1%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 328 356 254 74 161 195
Base content per 1 kb (bases) 480 520 371 108 235 285
Base content (%) 48.0% 52.0%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 76 92 61 15 35 57
Base content per 1 kb (bases) 452 548 363 89 208 339
Base content (%) 45.2% 54.8%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 754 797 492 262 379 418
Base content per 1 kb (bases) 486 514 317 169 244 270
Base content (%) 48.6% 51.4%
COX2 (size: 687 bases) GC AT G C A T
Base content (bases) 334 353 217 117 158 195
Base content per 1 kb (bases) 486 514 316 170 230 284
Base content (%) 48.6% 51.4%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 385 399 260 125 183 216
Base content per 1 kb (bases) 491 509 332 159 233 276
Base content (%) 49.1% 50.9%
CYTB (size: 1920 bases) GC AT G C A T
Base content (bases) 934 986 670 264 445 541
Base content per 1 kb (bases) 486 514 349 138 232 282
Base content (%) 48.6% 51.4%
ND1 (size: 978 bases) GC AT G C A T
Base content (bases) 458 520 304 154 257 263
Base content per 1 kb (bases) 468 532 311 157 263 269
Base content (%) 46.8% 53.2%
ND2 (size: 1039 bases) GC AT G C A T
Base content (bases) 493 546 369 124 233 313
Base content per 1 kb (bases) 474 526 355 119 224 301
Base content (%) 47.4% 52.6%
ND3 (size: 351 bases) GC AT G C A T
Base content (bases) 178 173 122 56 87 86
Base content per 1 kb (bases) 507 493 348 160 248 245
Base content (%) 50.7% 49.3%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 665 713 494 171 308 405
Base content per 1 kb (bases) 483 517 358 124 224 294
Base content (%) 48.3% 51.7%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 140 157 97 43 78 79
Base content per 1 kb (bases) 471 529 327 145 263 266
Base content (%) 47.1% 52.9%
ND5 (size: 1824 bases) GC AT G C A T
Base content (bases) 866 958 613 253 398 560
Base content per 1 kb (bases) 475 525 336 139 218 307
Base content (%) 47.5% 52.5%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 259 263 195 64 61 202
Base content per 1 kb (bases) 496 504 374 123 117 387
Base content (%) 49.6% 50.4%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 7 (3.08%)
Alanine (Ala, A)
n = 18 (7.93%)
Serine (Ser, S)
n = 15 (6.61%)
Threonine (Thr, T)
n = 21 (9.25%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 8 (3.52%)
Leucine (Leu, L)
n = 58 (25.55%)
Isoleucine (Ile, I)
n = 20 (8.81%)
Methionine (Met, M)
n = 10 (4.41%)
Proline (Pro, P)
n = 17 (7.49%)
Phenylalanine (Phe, F)
n = 9 (3.96%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 11 (4.85%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 5 (2.2%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 16 8 5 15 26 7 5 8 0 0 4 2 2 2 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 2 11 5 0 0 5 2 0 3 6 6 2 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 13 0 2 7 1 0 0 5 1 2 0 0 3 8 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 4 0 1 0 3 0 1 1 1 2 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
38 88 70 32
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
21 66 36 105
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 100 89 24
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPAPWFSIMVMTWLTLALLIQPKLLAFTATNPPSNKISLTTKPTPWSWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 4 (7.27%)
Serine (Ser, S)
n = 4 (7.27%)
Threonine (Thr, T)
n = 8 (14.55%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.82%)
Leucine (Leu, L)
n = 8 (14.55%)
Isoleucine (Ile, I)
n = 3 (5.45%)
Methionine (Met, M)
n = 3 (5.45%)
Proline (Pro, P)
n = 9 (16.36%)
Phenylalanine (Phe, F)
n = 2 (3.64%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 3 (5.45%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 3 (5.45%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 3 2 1 3 2 2 0 1 1 0 0 1 0 1 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 1 3 0 0 0 0 0 1 1 6 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 1 0 0 1 3 0 0 0 0 0 0 0 1 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 0 0 3 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
5 19 20 12
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 25 9 17
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 17 28 6
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.11%)
Alanine (Ala, A)
n = 46 (8.91%)
Serine (Ser, S)
n = 27 (5.23%)
Threonine (Thr, T)
n = 39 (7.56%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 36 (6.98%)
Leucine (Leu, L)
n = 64 (12.4%)
Isoleucine (Ile, I)
n = 41 (7.95%)
Methionine (Met, M)
n = 24 (4.65%)
Proline (Pro, P)
n = 30 (5.81%)
Phenylalanine (Phe, F)
n = 41 (7.95%)
Tyrosine (Tyr, Y)
n = 17 (3.29%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 15 (2.91%)
Glutamine (Gln, Q)
n = 10 (1.94%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 28 19 4 13 35 9 2 10 0 6 14 15 1 12 29
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 1 5 30 11 0 5 13 23 6 4 12 11 3 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 13 2 4 8 11 1 0 3 0 17 1 1 3 12 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
18 9 1 4 11 9 0 0 1 7 0 0 1 0 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
154 128 132 103
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 139 95 206
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
31 225 191 70
COX2 (size: 687 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.95%)
Alanine (Ala, A)
n = 17 (7.46%)
Serine (Ser, S)
n = 21 (9.21%)
Threonine (Thr, T)
n = 12 (5.26%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 17 (7.46%)
Leucine (Leu, L)
n = 30 (13.16%)
Isoleucine (Ile, I)
n = 19 (8.33%)
Methionine (Met, M)
n = 7 (3.07%)
Proline (Pro, P)
n = 14 (6.14%)
Phenylalanine (Phe, F)
n = 8 (3.51%)
Tyrosine (Tyr, Y)
n = 8 (3.51%)
Tryptophan (Trp, W)
n = 5 (2.19%)
Aspartic acid (Asp, D)
n = 13 (5.7%)
Glutamic acid (Glu, E)
n = 14 (6.14%)
Asparagine (Asn, N)
n = 5 (2.19%)
Glutamine (Gln, Q)
n = 7 (3.07%)
Histidine (His, H)
n = 10 (4.39%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 5 (2.19%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 12 6 3 10 8 6 2 7 0 3 4 8 2 3 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 3 2 10 4 1 1 2 3 3 2 4 8 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 7 0 0 7 10 1 0 3 2 6 1 1 2 3 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 10 4 2 11 3 1 1 1 2 1 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 63 50 46
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 61 62 81
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 93 83 31
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 22 (8.46%)
Serine (Ser, S)
n = 19 (7.31%)
Threonine (Thr, T)
n = 21 (8.08%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 13 (5.0%)
Leucine (Leu, L)
n = 33 (12.69%)
Isoleucine (Ile, I)
n = 16 (6.15%)
Methionine (Met, M)
n = 10 (3.85%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 9 (3.46%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 4 (1.54%)
Glutamine (Gln, Q)
n = 6 (2.31%)
Histidine (His, H)
n = 18 (6.92%)
Lysine (Lys, K)
n = 4 (1.54%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 12 7 2 11 14 4 1 5 1 3 4 6 0 2 22
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 1 13 8 0 0 7 11 2 2 1 7 2 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 10 0 2 5 7 0 2 3 1 8 0 1 0 4 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
16 7 1 0 4 3 1 0 0 5 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 72 60 62
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 69 53 96
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 119 103 24
CYTB (size: 1920 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 41 (6.42%)
Alanine (Ala, A)
n = 49 (7.67%)
Serine (Ser, S)
n = 38 (5.95%)
Threonine (Thr, T)
n = 41 (6.42%)
Cysteine (Cys, C)
n = 7 (1.1%)
Valine (Val, V)
n = 31 (4.85%)
Leucine (Leu, L)
n = 112 (17.53%)
Isoleucine (Ile, I)
n = 53 (8.29%)
Methionine (Met, M)
n = 13 (2.03%)
Proline (Pro, P)
n = 43 (6.73%)
Phenylalanine (Phe, F)
n = 50 (7.82%)
Tyrosine (Tyr, Y)
n = 23 (3.6%)
Tryptophan (Trp, W)
n = 19 (2.97%)
Aspartic acid (Asp, D)
n = 15 (2.35%)
Glutamic acid (Glu, E)
n = 12 (1.88%)
Asparagine (Asn, N)
n = 29 (4.54%)
Glutamine (Gln, Q)
n = 12 (1.88%)
Histidine (His, H)
n = 20 (3.13%)
Lysine (Lys, K)
n = 17 (2.66%)
Arginine (Arg, R)
n = 14 (2.19%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 46 12 7 22 68 12 3 11 1 1 5 23 2 6 44
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 7 7 31 11 0 0 15 23 3 1 15 25 2 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
26 9 1 1 12 21 2 0 2 3 20 2 0 4 25 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
17 8 4 1 14 14 3 1 2 11 0 0 0 1 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
148 198 155 139
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
83 169 129 259
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
33 303 257 47
ND1 (size: 978 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (4.62%)
Alanine (Ala, A)
n = 32 (9.85%)
Serine (Ser, S)
n = 27 (8.31%)
Threonine (Thr, T)
n = 18 (5.54%)
Cysteine (Cys, C)
n = 3 (0.92%)
Valine (Val, V)
n = 18 (5.54%)
Leucine (Leu, L)
n = 58 (17.85%)
Isoleucine (Ile, I)
n = 19 (5.85%)
Methionine (Met, M)
n = 22 (6.77%)
Proline (Pro, P)
n = 24 (7.38%)
Phenylalanine (Phe, F)
n = 20 (6.15%)
Tyrosine (Tyr, Y)
n = 14 (4.31%)
Tryptophan (Trp, W)
n = 8 (2.46%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.38%)
Asparagine (Asn, N)
n = 9 (2.77%)
Glutamine (Gln, Q)
n = 6 (1.85%)
Histidine (His, H)
n = 2 (0.62%)
Lysine (Lys, K)
n = 7 (2.15%)
Arginine (Arg, R)
n = 8 (2.46%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 12 14 4 9 32 6 6 4 2 3 8 4 3 8 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 0 3 7 15 10 0 0 7 6 2 7 10 6 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 10 1 6 5 9 0 1 6 3 11 0 1 0 9 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 6 5 0 4 7 0 0 1 5 2 0 1 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
80 91 83 72
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 94 53 137
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
32 119 127 48
ND2 (size: 1039 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (3.19%)
Alanine (Ala, A)
n = 39 (11.3%)
Serine (Ser, S)
n = 32 (9.28%)
Threonine (Thr, T)
n = 35 (10.14%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 11 (3.19%)
Leucine (Leu, L)
n = 64 (18.55%)
Isoleucine (Ile, I)
n = 25 (7.25%)
Methionine (Met, M)
n = 21 (6.09%)
Proline (Pro, P)
n = 23 (6.67%)
Phenylalanine (Phe, F)
n = 13 (3.77%)
Tyrosine (Tyr, Y)
n = 8 (2.32%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 12 (3.48%)
Glutamine (Gln, Q)
n = 9 (2.61%)
Histidine (His, H)
n = 9 (2.61%)
Lysine (Lys, K)
n = 13 (3.77%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 19 16 7 15 29 5 8 8 1 1 3 5 2 3 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 1 5 21 11 2 0 7 2 2 1 9 13 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 17 0 2 12 10 1 0 7 0 8 1 0 3 9 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 3 2 0 2 10 3 0 2 1 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 100 113 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 122 58 134
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 147 142 33
ND3 (size: 1039 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (3.19%)
Alanine (Ala, A)
n = 39 (11.3%)
Serine (Ser, S)
n = 32 (9.28%)
Threonine (Thr, T)
n = 35 (10.14%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 11 (3.19%)
Leucine (Leu, L)
n = 64 (18.55%)
Isoleucine (Ile, I)
n = 25 (7.25%)
Methionine (Met, M)
n = 21 (6.09%)
Proline (Pro, P)
n = 23 (6.67%)
Phenylalanine (Phe, F)
n = 13 (3.77%)
Tyrosine (Tyr, Y)
n = 8 (2.32%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 12 (3.48%)
Glutamine (Gln, Q)
n = 9 (2.61%)
Histidine (His, H)
n = 9 (2.61%)
Lysine (Lys, K)
n = 13 (3.77%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 19 16 7 15 29 5 8 8 1 1 3 5 2 3 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 1 5 21 11 2 0 7 2 2 1 9 13 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 17 0 2 12 10 1 0 7 0 8 1 0 3 9 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 3 2 0 2 10 3 0 2 1 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 100 113 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 122 58 134
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 147 142 33
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (4.59%)
Alanine (Ala, A)
n = 32 (6.99%)
Serine (Ser, S)
n = 39 (8.52%)
Threonine (Thr, T)
n = 44 (9.61%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 12 (2.62%)
Leucine (Leu, L)
n = 99 (21.62%)
Isoleucine (Ile, I)
n = 40 (8.73%)
Methionine (Met, M)
n = 26 (5.68%)
Proline (Pro, P)
n = 29 (6.33%)
Phenylalanine (Phe, F)
n = 17 (3.71%)
Tyrosine (Tyr, Y)
n = 14 (3.06%)
Tryptophan (Trp, W)
n = 12 (2.62%)
Aspartic acid (Asp, D)
n = 1 (0.22%)
Glutamic acid (Glu, E)
n = 10 (2.18%)
Asparagine (Asn, N)
n = 13 (2.84%)
Glutamine (Gln, Q)
n = 12 (2.62%)
Histidine (His, H)
n = 14 (3.06%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 34 18 5 18 60 10 5 10 2 0 6 4 2 2 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 0 3 3 16 11 2 0 10 7 4 1 13 13 2 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
22 15 1 4 12 12 3 0 8 1 13 2 1 0 13 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 9 1 0 1 9 1 1 2 7 1 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
76 159 141 83
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
55 136 74 194
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
40 199 190 30
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 6 (6.12%)
Alanine (Ala, A)
n = 7 (7.14%)
Serine (Ser, S)
n = 14 (14.29%)
Threonine (Thr, T)
n = 6 (6.12%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 5 (5.1%)
Leucine (Leu, L)
n = 18 (18.37%)
Isoleucine (Ile, I)
n = 4 (4.08%)
Methionine (Met, M)
n = 7 (7.14%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 7 (7.14%)
Tyrosine (Tyr, Y)
n = 1 (1.02%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 3 (3.06%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 6 (6.12%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 2 6 1 2 10 4 1 2 0 0 2 3 0 1 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 2 1 4 2 0 1 3 2 0 1 0 1 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 2 0 0 6 5 0 0 3 0 1 0 0 0 3 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 2 1 1 0 0 0 0 1 1 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
22 29 23 25
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
15 26 17 41
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 42 39 12
ND5 (size: 1824 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 33 (5.44%)
Alanine (Ala, A)
n = 57 (9.39%)
Serine (Ser, S)
n = 39 (6.43%)
Threonine (Thr, T)
n = 64 (10.54%)
Cysteine (Cys, C)
n = 6 (0.99%)
Valine (Val, V)
n = 21 (3.46%)
Leucine (Leu, L)
n = 99 (16.31%)
Isoleucine (Ile, I)
n = 50 (8.24%)
Methionine (Met, M)
n = 35 (5.77%)
Proline (Pro, P)
n = 33 (5.44%)
Phenylalanine (Phe, F)
n = 34 (5.6%)
Tyrosine (Tyr, Y)
n = 11 (1.81%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 7 (1.15%)
Glutamic acid (Glu, E)
n = 13 (2.14%)
Asparagine (Asn, N)
n = 26 (4.28%)
Glutamine (Gln, Q)
n = 19 (3.13%)
Histidine (His, H)
n = 15 (2.47%)
Lysine (Lys, K)
n = 23 (3.79%)
Arginine (Arg, R)
n = 10 (1.65%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 37 23 5 22 51 16 4 16 3 2 6 10 3 12 22
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
12 0 6 6 35 16 0 0 9 20 4 2 13 15 3 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
34 22 0 4 12 11 2 1 9 1 10 1 1 2 24 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 8 5 1 6 22 1 2 1 7 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
131 171 208 98
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
71 183 115 239
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
51 259 237 61
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (15.61%)
Alanine (Ala, A)
n = 17 (9.83%)
Serine (Ser, S)
n = 10 (5.78%)
Threonine (Thr, T)
n = 4 (2.31%)
Cysteine (Cys, C)
n = 3 (1.73%)
Valine (Val, V)
n = 31 (17.92%)
Leucine (Leu, L)
n = 22 (12.72%)
Isoleucine (Ile, I)
n = 3 (1.73%)
Methionine (Met, M)
n = 7 (4.05%)
Proline (Pro, P)
n = 4 (2.31%)
Phenylalanine (Phe, F)
n = 18 (10.4%)
Tyrosine (Tyr, Y)
n = 7 (4.05%)
Tryptophan (Trp, W)
n = 5 (2.89%)
Aspartic acid (Asp, D)
n = 2 (1.16%)
Glutamic acid (Glu, E)
n = 3 (1.73%)
Asparagine (Asn, N)
n = 3 (1.73%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 1 (0.58%)
Lysine (Lys, K)
n = 1 (0.58%)
Arginine (Arg, R)
n = 5 (2.89%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 0 1 2 0 2 3 4 0 0 13 1 4 13 14 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 2 1 5 0 4 8 6 1 3 17 3 0 1 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 0 2 1 1 5 1 0 4 3 1 11 2 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 0 3 2 0 0 1 0 0 0 5 0 0 0 1 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
80 17 19 58
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
41 34 18 81
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
74 13 24 63
Total protein-coding genes (size: 12183 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 242 (5.96%)
Alanine (Ala, A)
n = 351 (8.65%)
Serine (Ser, S)
n = 293 (7.22%)
Threonine (Thr, T)
n = 319 (7.86%)
Cysteine (Cys, C)
n = 32 (0.79%)
Valine (Val, V)
n = 211 (5.2%)
Leucine (Leu, L)
n = 693 (17.07%)
Isoleucine (Ile, I)
n = 297 (7.32%)
Methionine (Met, M)
n = 189 (4.66%)
Proline (Pro, P)
n = 247 (6.09%)
Phenylalanine (Phe, F)
n = 252 (6.21%)
Tyrosine (Tyr, Y)
n = 117 (2.88%)
Tryptophan (Trp, W)
n = 115 (2.83%)
Aspartic acid (Asp, D)
n = 68 (1.68%)
Glutamic acid (Glu, E)
n = 99 (2.44%)
Asparagine (Asn, N)
n = 136 (3.35%)
Glutamine (Gln, Q)
n = 97 (2.39%)
Histidine (His, H)
n = 119 (2.93%)
Lysine (Lys, K)
n = 95 (2.34%)
Arginine (Arg, R)
n = 78 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
72 225 134 49 149 348 87 43 86 11 32 62 86 31 66 186
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
55 3 29 46 194 98 13 13 80 104 45 29 86 116 16 46
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
147 121 5 28 89 106 15 5 50 16 101 10 17 21 115 13
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
106 71 28 12 56 84 11 6 13 48 11 0 2 7 1 105
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
971 1174 1093 822
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
524 1155 739 1642
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
358 1688 1557 457

<!DOCTYPE html>
<html lang="en" >
<head >
    <meta charset="UTF-8">
    <meta http-equiv="X-UA-Compatible" content="IE=edge">
    <meta name="HandheldFriendly" content="True">
    <meta name="MobileOptimized" content="320">
    <meta name="viewport" content="width=device-width, initial-scale=1.0">
    <title>400 Error - NCBI</title>
    <meta name="viewport" content="width=device-width, initial-scale=1, shrink-to-fit=no">
    <meta http-equiv="X-UA-Compatible" content="IE=edge" />
    <meta http-equiv="Content-Type" content="text/html; charset=utf-8" />
    <meta http-equiv="X-UA-Compatible" content="IE=edge,chrome=1" />
    <meta name="title" content="400 Error - NCBI">
    <meta name="robots" content="noindex">
    <meta name="googlebot" content="noindex">
    <style>

      /* USWDS Banner Styles */
      .usa-banner{
        background-color:#f1f1f1;
        padding-bottom:0.7rem;
      }

      @media screen and (min-width: 481px){
        .usa-banner{
          font-size:1.3rem;
          padding-bottom:0;
        }
      }

      .usa-banner .usa-accordion, .usa-banner .usa-accordion-bordered{
        margin-top:0;
        margin-bottom:0;
        list-style-type:none;
        padding-left:0;
        color:#212121;
        margin:0;
        padding:0;
        width:100%;
      }

      .usa-banner .usa-banner-header{
        padding-top:0.55rem;
        padding-bottom:0.55rem;
        font-size:0.75rem;
        font-weight:400;
      }

      @media screen and (min-width: 481px){
        .usa-banner .usa-banner-header{
          padding-top:0;
          padding-bottom:0;
        }
      }

      .usa-banner .usa-banner-inner{
        max-width:1040px;
        margin-left:auto;
        margin-right:auto;
        padding-right:1.5rem;
        padding-left:1.5rem;
      }

      .usa-banner .usa-banner-inner::after{
        clear:both;
        content:"";
        display:block;
      }

      @media screen and (min-width: 951px){
        .usa-banner .usa-banner-inner{
          padding-right:3rem;
          padding-left:3rem;
        }
      }

      .usa-banner .usa-banner-header-expanded{
        -ms-flex-align:center;
        align-items:center;
        border-bottom:1px solid #aeb0b5;
        display:-ms-flexbox;
        display:flex;
        font-size:0.75rem;
        min-height:0rem;
        padding-right:3rem;
      }

      @media screen and (min-width: 481px){
        .usa-banner .usa-banner-header-expanded{
          border-bottom:none;
          display:block;
          font-size:0.75rem;
          font-weight:400;
          min-height:0;
          padding-right:0;
        }
      }

      .usa-banner .usa-banner-header-expanded > .usa-banner-inner{
        margin-left:0;
      }

      @media screen and (min-width: 481px){
        .usa-banner .usa-banner-header-expanded > .usa-banner-inner{
          margin-left:auto;
        }
      }

      .usa-banner .usa-section > :first-child,
      .usa-banner .usa-grid > :first-child,
      .usa-banner .usa-grid-full > :first-child{
        margin-top:0;
      }

      .usa-banner .usa-section > :last-child,
      .usa-banner .usa-grid > :last-child,
      .usa-banner .usa-grid-full > :last-child{
        margin-bottom:0;
      }

      .usa-banner img{
        border:0;
      }

      .usa-banner img{
        max-width:100%;
      }

      .usa-banner .usa-banner-header img{
        float:left;
        margin-right:1rem;
        margin-top:1px;
        width:1.5rem;
      }

      @media screen and (min-width: 481px){
        .usa-banner .usa-banner-header img{
          margin-right:0.7rem;
          width:1.3rem;
        }
      }

      .usa-banner .usa-banner-header-expanded img{
        margin-right:1rem;
      }

      @media screen and (min-width: 481px){
        .usa-banner .usa-banner-header-expanded img{
          margin-right:0.7rem;
        }
      }

      .usa-banner p{
        line-height:1.5;
        /*margin-bottom:1em;
        margin-top:1em;*/
      }

      .usa-banner .usa-banner-header p{
        margin-top:0;
        margin-bottom:0;
        display:inline;
        overflow:hidden;
        vertical-align:middle;
      }

      @media screen and (min-width: 481px){
        .usa-banner .usa-banner-header p{
          margin-top:2px;
          margin-bottom:2px;
          display:inline-block;
        }
      }

      .usa-banner .usa-banner-header-expanded p{
        line-height:1.3;
        vertical-align:top;
        font-size: 0.95rem;
      }

      @media screen and (min-width: 481px){
        .usa-banner .usa-banner-header-expanded p{
          line-height:1.5;
          vertical-align:middle;
          font-size: 0.75rem;
        }
      }

      .usa-banner .usa-accordion-button.usa-banner-button{
        background-color:transparent;
        border:0;
        border-radius:0;
        font-weight:400;
        margin:0;
        padding:0;
        text-align:left;
        -webkit-font-smoothing:auto;
        padding-top:0;
        padding-left:4.0rem;
        background-position-x:right;
        color:#0071bc;
        display:block;
        font-size:0.7rem;
        height:4.3rem;
        left:0;
        position:absolute;
        text-decoration:underline;
        top:0;
        width:100%;
      }

      .usa-banner .usa-banner-button:hover{
        background-color:transparent;
      }

      @media screen and (min-width: 481px){
        .usa-banner .usa-accordion-button.usa-banner-button{
          padding-top:0;
          padding-left:0;
          display:inline;
          height:auto;
          margin-left:3px;
          position:relative;
          vertical-align:middle;
          width:auto;
        }
      }

      .usa-banner .usa-accordion-button.usa-banner-button:hover{
        color:#205493;
        text-decoration:underline;
      }

      .usa-banner .usa-accordion-button.usa-banner-button[aria-expanded=false]{
        background-image:none;
      }

      .usa-banner .usa-banner-button[aria-expanded=false]::after{
        background-image:url("https://www.ncbi.nlm.nih.gov/style-guide/static/django_uswds/uswds/img/angle-arrow-down-primary.png");
        background-image:url("https://www.ncbi.nlm.nih.gov/style-guide/static/django_uswds/uswds/img/angle-arrow-down-primary.svg");
        background-size:100%;
        content:'';
        display:inline-block;
        height:0.7rem;
        width:0.7rem;
        margin-left:0;
      }

      .usa-banner .usa-banner-button[aria-expanded=false]:hover::after{
        background-image:url("https://www.ncbi.nlm.nih.gov/style-guide/static/django_uswds/uswds/img/angle-arrow-down-primary-hover.png");
        background-image:url("https://www.ncbi.nlm.nih.gov/style-guide/static/django_uswds/uswds/img/angle-arrow-down-primary-hover.svg");
      }

      .usa-banner .usa-banner-button[aria-expanded=false]::after{
        background-position-y:1px;
      }

      .usa-banner .usa-banner-button[aria-expanded=true]{
        background-image:none;
        height:3.1rem;
      }

      .usa-banner .usa-banner-button[aria-expanded=true]::after{
        background-image:url("https://www.ncbi.nlm.nih.gov/style-guide/static/django_uswds/uswds/img/close.png");
        background-image:url("https://www.ncbi.nlm.nih.gov/style-guide/static/django_uswds/uswds/img/close.svg");
        background-size:100%;
        content:'';
        display:inline-block;
        height:0.9rem;
        width:0.9rem;
        margin-left:0;
      }

      @media screen and (min-width: 481px){
        .usa-banner .usa-banner-button[aria-expanded=true]{
          height:initial;
          padding:0;
          position:relative;
        }
        .usa-banner .usa-banner-button[aria-expanded=true]::after{
          background-image:url("https://www.ncbi.nlm.nih.gov/style-guide/static/django_uswds/uswds/img/angle-arrow-up-primary.png");
          background-image:url("https://www.ncbi.nlm.nih.gov/style-guide/static/django_uswds/uswds/img/angle-arrow-up-primary.svg");
          background-size:100%;
          content:'';
          display:inline-block;
          height:0.7rem;
          width:0.7rem;
          margin-left:0;
        }
        .usa-banner .usa-banner-button[aria-expanded=true]:hover::after{
          background-image:url("https://www.ncbi.nlm.nih.gov/style-guide/static/django_uswds/uswds/img/angle-arrow-up-primary-hover.png");
          background-image:url("https://www.ncbi.nlm.nih.gov/style-guide/static/django_uswds/uswds/img/angle-arrow-up-primary-hover.svg");
        }
        .usa-banner .usa-banner-button[aria-expanded=true]::after{
          background-position-y:1px;
        }
      }

      .usa-banner .usa-banner-button[aria-expanded=true]::after{
        position:absolute;
        right:1.0rem;
        top:1.15rem;
      }

      @media screen and (min-width: 481px){
        .usa-banner .usa-banner-button[aria-expanded=true]::after{
          position:static;
        }
      }

      .usa-banner .usa-banner-button[aria-expanded=true] .usa-banner-button-text{
        display:none;
      }

      @media screen and (min-width: 481px){
        .usa-banner .usa-banner-button[aria-expanded=true] .usa-banner-button-text{
          display:inline;
        }
      }

      .usa-banner .usa-accordion-button{
        background-color:transparent;
        border:0;
        border-radius:0;
        font-weight:400;
        margin:0;
        padding:0;
        text-align:left;
        -webkit-font-smoothing:auto;
        background-color:#f1f1f1;
        background-image:url("https://www.ncbi.nlm.nih.gov/style-guide/static/django_uswds/uswds/img/minus.png");
        background-image:url("https://www.ncbi.nlm.nih.gov/style-guide/static/django_uswds/uswds/img/minus.svg");
        background-position:right 2rem center;
        background-repeat:no-repeat;
        background-size:1.5rem;
        color:#212121;
        cursor:pointer;
        display:inline-block;
        font-family:"Source Sans Pro", "Helvetica Neue", "Helvetica", "Roboto", "Arial", sans-serif;
        font-weight:700;
        margin:0;
        padding:1.5rem 5.5rem 1.5rem 2rem;
        width:100%;
      }

      .usa-banner .usa-accordion-button:hover{
        background-color:transparent;
      }

      .usa-banner .usa-accordion-button:hover{
        /*background-color:#d6d7d9;*/
        color:#212121;
      }

      .usa-banner .usa-accordion-button h1,
      .usa-banner .usa-accordion-button h2,
      .usa-banner .usa-accordion-button h3,
      .usa-banner .usa-accordion-button h4,
      .usa-banner .usa-accordion-button h5,
      .usa-banner .usa-accordion-button h6{
        margin:0;
      }

      .usa-banner .usa-accordion-button[aria-expanded=false]{
        background-image:url("https://www.ncbi.nlm.nih.gov/style-guide/static/django_uswds/uswds/img/plus.png");
        background-image:url("https://www.ncbi.nlm.nih.gov/style-guide/static/django_uswds/uswds/img/plus.svg");
        background-repeat:no-repeat;
        background-size:1.5rem;
      }

      .usa-banner .usa-accordion-content.usa-banner-content{
        padding-right:1.5rem;
        padding-bottom:3px;
        padding-left:1.5rem;
        background-color:transparent;
        font-size:0.9375rem;
        padding-top:1.5rem;
        width:100%;
      }

      @media screen and (min-width: 600px){
        .usa-banner .usa-accordion-content.usa-banner-content{
          padding-bottom:2rem;
          padding-top:2rem;
        }
      }

      @media screen and (min-width: 951px){
        .usa-banner .usa-accordion-content.usa-banner-content{
          padding-right:1.2rem;
          padding-left:1.2rem;
        }
      }

      .usa-banner .usa-banner-content p:first-child{
        margin-top:1rem;
      }

      @media screen and (min-width: 600px){
        .usa-banner .usa-banner-content p:first-child{
          margin-top:0;
        }
      }

      .usa-banner .usa-accordion-bordered .usa-accordion-content{
        border-bottom:3px solid #f1f1f1;
        border-left:3px solid #f1f1f1;
        border-right:3px solid #f1f1f1;
      }

      .usa-banner .usa-accordion-content{
        background-color:#ffffff;
        overflow:auto;
        padding:1.5rem 2rem;
      }

      .usa-banner .usa-accordion-content > *:first-child{
        margin-top:0;
      }

      .usa-banner .usa-accordion-content > *:last-child{
        margin-bottom:0;
      }

      .usa-banner .usa-accordion-content:not([aria-hidden]){
        position:absolute;
        left:-999em;
      }

      .usa-banner .usa-accordion-content[aria-hidden=true]{
        display:none;
      }

      @media screen and (min-width: 600px){
        .usa-banner .usa-width-one-half{
          float:left;
          display:block;
          margin-right:4.82916%;
          width:47.58542%;
        }
        .usa-banner .usa-width-one-half:last-child{
          margin-right:0;
        }
      }

      @media screen and (min-width: 1201px){
        .usa-banner .usa-width-one-half{
          float:left;
          display:block;
          margin-right:2.35765%;
          width:48.82117%;
        }
        .usa-banner .usa-width-one-half:last-child{
          margin-right:0;
        }
      }

      .usa-banner .usa-width-one-half:first-child > :first-child {
        margin-top:0;
      }

      @media screen and (min-width: 600px){
        .usa-banner .usa-width-one-half > :first-child {
          margin-top:0;
        }
      }

      .usa-banner .usa-width-one-half:last-child > :last-child {
        margin-bottom:0;
      }

      @media screen and (min-width: 600px){
        .usa-banner .usa-width-one-half > :last-child {
          margin-bottom:0;
        }
      }

      .usa-banner .usa-media_block-img{
        float:left;
        margin-right:1rem;
      }

      .usa-banner .usa-banner-icon{
        width:2.4rem;
      }

      .usa-banner .usa-media_block-body{
        overflow:hidden;
      }

      .usa-banner strong{
        font-weight:bold;
      }

      /* USWDS */
      .usa-list{
        margin-bottom:1em;
        margin-top:1em;
        line-height:1.5;
        padding-left:3ch;
      }
      .usa-list:last-child{
        margin-bottom:0;
      }

      .usa-list li{
        margin-bottom:0.25em;
        max-width:68ex;
      }
      .usa-list li:last-child{
        margin-bottom:0;
      }

      .usa-list--unstyled{
        margin-bottom:0;
        margin-top:0;
        list-style-type:none;
        padding-left:0;
      }
      .usa-list--unstyled > li{
        margin-bottom:0;
        max-width:unset;
      }

      .usa-prose .usa-list--unstyled{
        margin-bottom:0;
        margin-top:0;
        list-style-type:none;
        padding-left:0;
      }
      .usa-prose .usa-list--unstyled > li{
        margin-bottom:0;
        max-width:unset;
      }

      .margin-bottom-3 {
        margin-bottom:1.5rem;
      }
      .margin-bottom-6{
        margin-bottom:3rem;
      }
      @media (min-width: 480px) {
        .mobile\:margin-bottom-3 {
          margin-bottom:1.5rem;
        }
        .mobile\:margin-bottom-6 {
          margin-bottom:3rem;
        }
      }

      .usa-sr-only{
        position:absolute;
        left:-999em;
      }

      .grid-container{
        padding-left: 15px;
        padding-right: 15px;
        margin-left:auto;
        margin-right:auto;
        max-width:980px;
      }

      .grid-row{
        display:-webkit-box;
        display:-ms-flexbox;
        display:flex;
        -ms-flex-wrap:wrap;
            flex-wrap:wrap;
      }
      .display-block {
        display: block;
      }

      .display-inline {
        display: inline;
      }

      .display-flex{
        display:-webkit-box;
        display:-ms-flexbox;
        display:flex;
      }

      .flex-justify{
        -webkit-box-pack: justify;
        -ms-flex-pack: justify;
        justify-content: space-between;
      }

      .flex-fill{
        -webkit-box-flex:1;
            -ms-flex:1 0 0px;
                flex:1 0 0;
      }
      .flex-auto{
        -webkit-box-flex:0;
            -ms-flex:0 0 auto;
                flex:0 0 auto;
      }

      @media all and (min-width: 640px){
        .mobile\:display-block {
          display: block;
        }
        .mobile\:display-inline {
          display: inline;
        }
        .mobile\:display-flex{
          display:-webkit-box;
          display:-ms-flexbox;
          display:flex;
        }
      }

      @media all and (min-width: 992px){
        .tablet\:display-block {
          display: block;
        }
        .tablet\:display-inline {
          display: inline;
        }
        .tablet\:display-flex{
          display:-webkit-box;
          display:-ms-flexbox;
          display:flex;
        }
      }

      .usa-button{
        font-family: "Roboto", "Helvetica Neue", Arial, Tahoma;
        font-size:1.06rem;
        line-height:0.9;
        -moz-osx-font-smoothing:grayscale;
        -webkit-font-smoothing:antialiased;
        -webkit-appearance:none;
          -moz-appearance:none;
                appearance:none;
        background-color:#0071bc;
        border:0;
        border-radius:0.25rem;
        color:white;
        cursor:pointer;
        font-weight:bold;
        margin-right:0.5rem;
        padding:0.75rem 1.25rem;
        text-align:center;
        text-decoration:none;
        width:100%;
      }
      @media all and (min-width: 384px){
        .usa-button{
          width:auto;
        }
      }
      .usa-button:visited{
        color:white;
      }
      .usa-button:active, .usa-button.usa-button--active{
        background-color:#0071bc;
        color:white;
      }
      .usa-button:not([disabled]):focus, .usa-button:not([disabled]).usa-focus{
        outline-offset:0.25rem;
      }
      .usa-button:disabled{
        -moz-osx-font-smoothing:grayscale;
        -webkit-font-smoothing:antialiased;
        background-color:#c9c9c9;
        color:white;
        pointer-events:none;
      }
      .usa-button:disabled:hover, .usa-button:disabled.usa-button--hover, .usa-button:disabled:active, .usa-button:disabled.usa-button--active, .usa-button:disabled:focus, .usa-button:disabled.usa-focus{
        background-color:#c9c9c9;
        border:0;
        -webkit-box-shadow:none;
                box-shadow:none;
      }
      .usa-search{
        font-family: "Roboto", "Helvetica Neue", Arial, Tahoma;
        font-size:1.06rem;
        line-height:1.5;
        position:relative;
      }
      .usa-search::after{
        clear:both;
        content:"";
        display:block;
      }
      .usa-search[role=search], .usa-search[role=search] > div,
      .usa-search [role=search]{
        display:-webkit-box;
        display:-ms-flexbox;
        display:flex;
      }
      .usa-search [type=submit]{
        background-image: url("data:image/svg+xml,%3Csvg xmlns='http://www.w3.org/2000/svg' width='65' height='64' viewBox='0 0 65 64'%3E%3Ctitle%3Esearch%3C/title%3E%3Cpath fill='%23FFF' d='M62.672 55.618L49.48 42.426c3.18-4.59 4.77-9.706 4.77-15.347 0-3.666-.713-7.173-2.137-10.519-1.423-3.347-3.347-6.231-5.77-8.656-2.422-2.425-5.307-4.346-8.652-5.769A26.606 26.606 0 0 0 27.17 0a26.61 26.61 0 0 0-10.52 2.135c-3.347 1.423-6.231 3.346-8.654 5.769-2.423 2.424-4.346 5.309-5.769 8.655A26.6 26.6 0 0 0 .092 27.077c0 3.667.712 7.172 2.135 10.52 1.423 3.345 3.346 6.23 5.769 8.652 2.424 2.424 5.308 4.347 8.655 5.77a26.606 26.606 0 0 0 10.519 2.135c5.641 0 10.757-1.591 15.347-4.77l13.191 13.153c.923.974 2.076 1.462 3.462 1.462 1.333 0 2.487-.487 3.46-1.462.975-.974 1.462-2.128 1.462-3.461 0-1.358-.473-2.513-1.422-3.46l.002.002zM39.345 39.252c-3.372 3.372-7.429 5.057-12.173 5.057s-8.801-1.685-12.173-5.057c-3.373-3.372-5.058-7.43-5.058-12.174 0-4.743 1.686-8.8 5.058-12.172 3.371-3.372 7.43-5.058 12.173-5.058s8.8 1.686 12.173 5.058c3.372 3.371 5.059 7.43 5.059 12.173 0 4.744-1.687 8.803-5.059 12.175v-.002z'/%3E%3C/svg%3E"), -webkit-gradient(linear, left top, left bottom, from(transparent), to(transparent));
        background-image: url("data:image/svg+xml,%3Csvg xmlns='http://www.w3.org/2000/svg' width='65' height='64' viewBox='0 0 65 64'%3E%3Ctitle%3Esearch%3C/title%3E%3Cpath fill='%23FFF' d='M62.672 55.618L49.48 42.426c3.18-4.59 4.77-9.706 4.77-15.347 0-3.666-.713-7.173-2.137-10.519-1.423-3.347-3.347-6.231-5.77-8.656-2.422-2.425-5.307-4.346-8.652-5.769A26.606 26.606 0 0 0 27.17 0a26.61 26.61 0 0 0-10.52 2.135c-3.347 1.423-6.231 3.346-8.654 5.769-2.423 2.424-4.346 5.309-5.769 8.655A26.6 26.6 0 0 0 .092 27.077c0 3.667.712 7.172 2.135 10.52 1.423 3.345 3.346 6.23 5.769 8.652 2.424 2.424 5.308 4.347 8.655 5.77a26.606 26.606 0 0 0 10.519 2.135c5.641 0 10.757-1.591 15.347-4.77l13.191 13.153c.923.974 2.076 1.462 3.462 1.462 1.333 0 2.487-.487 3.46-1.462.975-.974 1.462-2.128 1.462-3.461 0-1.358-.473-2.513-1.422-3.46l.002.002zM39.345 39.252c-3.372 3.372-7.429 5.057-12.173 5.057s-8.801-1.685-12.173-5.057c-3.373-3.372-5.058-7.43-5.058-12.174 0-4.743 1.686-8.8 5.058-12.172 3.371-3.372 7.43-5.058 12.173-5.058s8.8 1.686 12.173 5.058c3.372 3.371 5.059 7.43 5.059 12.173 0 4.744-1.687 8.803-5.059 12.175v-.002z'/%3E%3C/svg%3E"), linear-gradient(transparent, transparent);
        background-repeat:no-repeat;
        background-position:center center;
        background-size:1rem;
        border-bottom-left-radius:0;
        border-top-left-radius:0;
        height:2rem;
        margin:0;
        padding:0;
        width:3rem;
      }
      @media all and (min-width: 480px){
        .usa-search [type=submit]{
          padding-left:1rem;
          padding-right:1rem;
          background-image:none;
          width:auto;
        }
      }

      input[type=search]{
        -webkit-box-sizing:border-box;
                box-sizing:border-box;
        -webkit-appearance:none;
          -moz-appearance:none;
                appearance:none;
      }

      [type=search],
      .usa-search__input{
        padding-bottom:0;
        padding-top:0;
        border-bottom-right-radius:0;
        border-right:none;
        border-top-right-radius:0;
        -webkit-box-sizing:border-box;
                box-sizing:border-box;
        float:left;
        font-size:1rem;
        height:2rem;
        margin:0;
      }

      .usa-search .usa-button__reset {
        background: white;
        display: none;
        margin: 0;
        padding: 0;
        width: 41px;
      }

      .usa-search .usa-button__reset:hover,
      .usa-search .usa-button__reset:active {
        background-color: white;
      }


      .usa-search__submit-text{
        position:absolute;
        left:-999em;
      }
      @media all and (min-width: 480px){
        .usa-search__submit-text{
          position:static;
        }
      }

      /* FONT FACE - Roboto */
      /* latin */
      @font-face {
        font-family: 'Roboto';
        font-weight: 400;
        font-style: normal;
        font-display: auto;
        src: local('Roboto'), local('Roboto-Regular'),
          url('data:application/font-woff2;charset=utf-8;base64,d09GMgABAAAAAD8UABIAAAAAkDgAAD6tAAEAAAAAAAAAAAAAAAAAAAAAAAAAAAAAP0ZGVE0cGkIbmjgchBYGYACEEghUCYM8EQwKgdo8gcJOC4NyAAE2AiQDh0AEIAWFFweGfAyCSRsdgRVsm1YzOA9AqOLmUDjhjoeNA48R3rWMDAQbByA9yMz+/5bcGANu0OoLVgkiKgibLUwmC7PZaAfW069bVrtCnvyhf96rUZyIA+vlhqnQlMFLNfy6PeLzw82/ZQZ17xOVFHmh0uVz6zaM3cYyTVxEzOhSZ2DbyJ/k5OX5qI7+OxGZWdXPA8hrkcu/GsE7AH2HaG73K0aPDYkcIFhkxhhjdA1GZMqkN4MoQQVEwCi0sdPv1VliW7bjTBxSlKyD8PcIu+37q7C6Cjvg1wOPFlP9zDlQaWmLeCiQFJ+v1jTg/l/ouMgYnbR6765EwqPq+DpVowh2OQRHOq0ZWTLMaK17IKi5vaseaLUr27lL2En0wIJpVnEnJUXzBEV7339HpWQH/tl/vPSPJLdG58IpVrEnkGMKQsFnvIfLtJE0amVrt2/PTq+IBcAA+oAFwCBoAA1gAHz/c7oiHJKjLfwc2BwenZS5/mcu4XE7Tr26Ih3GYNJp8h0bfK0TiNbGthI+F6n4bE1YGFlw6q4qbpyChsz//7XUzt07sxR8CcufslzhCiSnPXGNEosnmf2ZAs9uiSaIqsCkyq6SSVVG1piqyipr6lNr1qur6kmO0QG7OyFJqDPyhOp53ZOZdE+SCS1gaClZnOQIkhxk9+gjOlTgPicfiSSwkMhCSEYh1ff/X9WyfRcYcofUcKX/NxdVCkX3CWyQjrYMdlVST6Q+BqCCCThJG1KsPA9/AvExCaIj3dAhhDbHpnDTblHucdFWhv7d6dsBfsEDoBYGVguCgOIsxqYHTy0KsRk8MeenP7XvLJGx5tWcwEFm5uOny8Tp+vM3CwkrRves7U3BGwFC8oggIWu/J/tj+j29OevdbveHihMQAgED2J9CAXz3nRdFA8Bn/sR1GfVnlePfAASGA3AhwKXAwEEegzzxHMwL30EQgAYUGOA44HQgQIGkgQBHOQuEuNFNrJ2BwANTyAQg9VBySBRQfFRAPBHoQgD3n73f9KxHPphMBOggpRQCDOjNMm8CGu/ljf3NNOvUqd+cS66649CrGq0Jd2qulupWvWq2Pk/Ld2STuqQrgXdGScwQGqeH8bC80N+loPKqw6nuLKDluyQ8jJNRbx2pOvF7Ieq5BeKFFYImblqwdPDoxAOCCx6cRJa55z2vPATHnucM8kVA4kGKjQ9jmXeV4a/Iw4QH1n+fZFzJHv6gjptJHjDLa+YDLGAFJ7j4rnnO45TvmZd8oPLiKh8FKEQRKKonD/SiD/0YwKAazmsjGMUYzmIaM5jFHOjqQl65iEuYVwt5aSl2Na9dD489HLRCvLLY+NVeMO44FKcDknr2aeYprbyhk/s64SAY0Jy3CXbGdgcaIre4ZppX1hEP52TmpOLYGEq58+mCwI6bAa6O1scC4ABOsOF1bw4cWPK4936ObDOAZZlXXHOL+5zk/ywxZ2XmmuJ0Gsqi81mwnxsmD38GRTbvaHi0og3t6PgcZCc0vFAwWGHM6I5llpfMAQtYwSUZhTM8OyMCoxjDWayqNRjb2MEubuAmbk3JyixvmMMCVnDBMEYwijGcxer74SxxcqfICxcUp9SZBmYwiznQnw+xxA4Jk3zYAdexh4P4CchCA61oQzs6urOyhmcH2Pd2Sja3VBZ0Z3p3ZgRmMQf6fxHEHAIKKzY4kk446ZTT5MhTokyFKnWatOjQpceCJWt2HDhy4sqdJy8+/OTJV6BQEYoSVKXKlKtRp16DRk06jRg15qwp02bMmkO3YMmabTt23XDTLbD9XxDAut3WSwifZsEZjMuTPFVfp7cirxdrn2W/UfkqR03NpgjwvwL5EpJ43VbeJyvdgOMXQLn3eSBD8os+rtwP0MlR7pvhqdK42/x2tizvGw/rOeBMQof+eHDkF7mH+qqVtOyRfqRDfz449KeLjUK7F9GnAtTtEkf/KnF9n+dRjvIsE880t1h6gfz5PMmtMBa3053ZvEknLtis5XE+YAfIEa7IwOYq3x2kLU9Tg6935VwqMgc4HUxKs5K5/iTOSKWtfMEAjYzae9ObXpsU5d5iL5Z7m1T9gqtfY+YeXcnJ7Gof+RPpA97M9t70A99qzP8WbOB0J6WgKKTVE5OYrzhl9KOibYgefuRso96Y/lc9T6V7cE9JWjYP34YL4cPTwoldEQeVXTU8kuX1lGzpB2iNhXJn8zJGtr7Nfh7SDE5GUnDIlV6jCNeew21UuC+Peg8WfzdPMx2O5Cu5I3o7+ruqOdj10m/qUG/hxSq8MCIIK4IkBUZK+J0QLicFckqQZIWFnLCSFx5KAlEWburCTkNYaIoALeGjLRg6wkZXOJkIiqkwMZNjLATNWiPciIfgBIFzFiauguMpzLwFy0eY+cZyyEMBUxLLhaocUs3LIXWaQFp1YPHyhrPpMQhlGLHHjDgLbSoWYRod3IIwWxQmS8JsTfO6IY/XdWhBd+Tx2oMIOtCCzmkRL5zkIpfHjUtkeUAtwK1RkQdzRgiMrPBSEhgVgVHLckBYgIXMPEYcOclKTBI83wLESmgINsKJ8OBcIBA3YeORRUI4NzTRHjsSNA+QRGkYeL1hWrSAxWQmK5jiIER4HOMumIfU6NBDW3kLzKpA1npzuWYLD5zkIje5yE1ucJGPgJCGAQn4z52CIE0ZM3W6sEyY4TchCkE470zEbCgOibyv48LhxOgmMlp10hGFhjDP09l4INqJ29e72rbHzYFbfN4zzXvWP56mZsgS+q4KUva5spiufw8TPNC+oaNzKL2Jo0GN5a3trGtlb2PgKnews/Hu5GhVSRHRXAiDzFhw2oWwPx3/2Ac9JiYaSP0PPqOA9KMiwgKAavx63UfFBBGA8WMSosnAkoNWYID7fXmgiReBmODjKEww+OCdJE+dfuXaot67q30sdwWVk6DK4kFFGjGlUHhB6gqI0Gg0GBQOzzzh3jaegLFpnJ4ln4u9p5Z9khUvr8WB37pYrvUSxOMmbAwqPeKuu9W/9EGw11sAiyMvvfDKa2+89c57H65H82v5UboEiT757IuvvvkenPmYZ69KSGC9fikBdd5janxTaOO7DvfYU4GLAm4JOB/ATW9rZwb0gfzdwD/gIXtzAzzoLQDzGosGOB84cA+hgORxEZH9MobwAXA1eAh8gBMy/Yc25dQXeq3v9L3zwfBH8MfwZ8IL4EXw4ngpvBJeE2+Mj8ePiomLY//9//83/4HACXidpVCORFPOiOfDCy1cEa/xmY3MtzzNcqpDPmT5V3//8H9d3h5ePlw6XDxkHM4ezhxOHtIO+w47DxsOww8VHl54cA16BJ4CCBzqEQVwByBsXr0lEQAfiWL6uNT1wanrK5S/QcTEJY5LSp04eer0GWkZWTl5BUUlZRVVNXUNTS1tHV09fQNDI2MTUzNzC0sraxtbO3sHRydnF1c3dw9PL28fXz//gEBQRCkprW3q6O3pG+gfHB4dGTtLGz83MTUzPUufu3jh0jwpIO7BoZH7Kd2xhAdJUaD4DSAeeNhjAcCjnwSGPpwbHAMAj3nyQVBeYePK6rWt3RvbOwxL7v709h0APP6be6DgRfnl1Mqq6or6BlD3pvbW5fUNMgBfeAIAXEKbbCWS7Qlmy1MRf66UW9sFE8qtAM506A+4uwV+iGGd18A9y2AWDffG51j149oWcGw/hAI4zcphhWDimLlcEv4f7mEcWH5LDQaRvRjwo6EA7pWGBYpgVVGfC0IudePepRGdN3vY1VHNXqKDu0sEWvlCoI0VRPzUfhApa9g0nLblboTpiu28qjTTX3PQOH6r7nKPoY0PMbKTUmRhvpthjK+elHwuf+pcc7tkOCWe5fZk+sTGQBtCCbrdm4kUFLRu8l0hz/Mwe5kwJXNJBFZlTVB3Kw09Cj+md2os8T/HYzQCNAZszaG/kuYQaK0kkdLdYjHiJvUmt/JXPLRLfHoDf6mF/0jioxgw0veX9ooQMJIAcl2WkAHPu507BYzPyZJTxo00W8fa0GD570k7/nXa9SfAP4ETvwDO/AwARty/n9t0pYcBZCj7ddEhSHBQIeyowAScPRV6AaEJz+QL+8AWFFJgyvZnA3TtqREC+CA+WPxMOsR6KP4wLAd7dmTcRRZcVDdBt+emSSP0CMBdOJCbB2QYyR5s0V5Ha4ZWjlWQPHSuHa3/D1BzPuLT4F3ARTue59FpNBiCbE+Lc+Vla0zrJaLs9HuvWFR6csaZ1WFyIpo8WF37qE9VyMJpo1BJxMVEOydbq7q3OWpvPM55cskmG846k94l02HXot73MTaI75LWY4yjETHVGp112JxYWBOlD51JLAXXah30kydWzQGNqZVOFlu3uRWdRQRaHd5PgpR44xVih4g1Nle8a2Qwp8WxdLK0pnBZkBAkymX/cJiuRYeYjudUcl79N7/up/6ThGa8+cP/UahaCNUs1AM5GcVAfrrGnLpUbJaMlVhk6Ago7ko1gqN/bReHGghLBosINyIdUW4IcimqGeM7C7FZJaPIyxPU7RiBSfOGkXhWkbaDIDcUK/XuSp8OxGRapHq52ZS95/rLKF2yK8Fiw7/j16u4sHGriT467JJe5vNbp6farGKGlZ8b29mZbNnNKSfb8cZETxMjCkKPeiGqHk/MmCodZkdhJSMgOfWYhOVIqfYpLoIb62HdBbXH9cnaiEYb+B7fdIlTTuJA1SptudmJhBm5QLowTFKh46WUcP15NSQM5FFvjMK5Cp5eX49gnPQSW1ypZsNdu1OgGl4WoBZ1wzJbxMVue63+9gI1S3KVuIQ3SEdc/uvKVORTwK6T5dTRWW0HsKwWVJfx4Gi9QciH9q1GLKrYnr4DJQqwFT7rZT7EAnKcry4+K/aglXSAbluJfqVapTozp00iaqvitRa4E7jYhvX8VLf2b1T1Wvy7cpvPZxfx/zW+OMtbcKtum/06vcZYPUvhgj5V11iUFKN06CubWDRbCpxlQmnndLzt7aBRdBPTkqlWAGeMgHkZF2cxOP1Hl0NuArFyI2M/gktyA4y9SJp0o/4FvEw0uNgpCuu8od5J5K1eiLUABdfZ2I8CViYS4iHMXKkTbKY9u5/xxwVts65iKfjvEqznVF49FRMqhwIZIxt22o9ZjbwZzMLp6dSVYdNOI8o1gJuTiMTQ/sOkN/VWSzLpJGwWOtQSqA+APr0XmZLV3twWjAFoT9CICxIWJCHeJP12rS/XWzPgfvlp4eA94ZxKnsdWuBiRCRidvxyS8v4BHe5TeshZyrlPQcnbN8CNaDIrglDBEIqSwsyiihBZ7AmlfECFOWXQHt/wWdbXuhVzKqskFXsugT766dgGxEVCSzi+ejZvVlICEu9Ns2iNDVrAyHioYITWq3DJFHBBnZi+AgVK70a8M5dcFiDHNneGNm4fatQRLpkHhGxB1Xv6OqUEA/VvPVbxIWOXMzAtsGglWdUnhz4FAzgF3SdhRSOe2od9eNTU+/gjnnvEmJzIuf6k9+2cdw7IvCLxqm68RslZ4UQpBn0aNWT3EBytixHfADhJaIstR1x2ig+KrkeHr40HmrouOI4gJNf7YRhWX8jz35qS04wIKuzobOIxkE8hOAS1pgWE3BOoIgH7DhllwEPaNigpv3BPikA6M6WB06T/XIqeVs8YvNKItSXPqPOBMsYb4IMlI1YVNm1cKatEBxx0LThLu2OLHmNVikUX2XYUg6uhbs0HKTE3Can5t3dXHmkE1zUT0GNquBnxrc1yvMvY+rKeX8c0dhDpG5F/EouGkKdQVE0UCBnJ2lhYVQlMfRRCr5EUqdJR12wcSEQ7d5oUhOCW3OhP+pAnA+4PKGBxYKUWG+W0EjdlsNXmdMECIbS6d2tmeyGf78QrOufdPnEQesBJNIFx0Xed/XuyusDK/6OlevEq/j9ZnMFyVZN91ZupDgEyDQX1ohJ5Ct2KR8e2Ezes4wWsW/TXYRrf9GiwrlMiqdQA6Kun6jIbXt20kowx8ik48sZavCNHThxLSDQb47zg+Vs35Ikz6tBKuKnQXbHGSA+BjJ1nrd+RQQozcSt4JFFA9RLaelWs7w6C6n5SYYhKfBmbUqBxm4eYf4dTqbP2FdJ3F0PcwobNU8xoCaSakkvTcbIBFZlEML4aleoaW0tB4LYq18lTDquuRWfzPbs7j3d29d7ONgJNIyS6KZ4IJw9zl8QJ2nRR5bzDtMS7czPKDD2Sia9u6hSNYIG+aOnoF+wvTMu41A/aKY5zO/EFnMh4+ewNA8qL9Jz5lh4ESFZSGOCBzjrgfI5gWs4Pat2drc4f/JkVlxLchu9Difv6Z6xtmnCyk7JRJ49dSn9dyeNV3v8FV1/m5uljCQ7IJQ6S56ZXRcIc/xow9qO8KSNPj/fCR9WXZLx65VlW9fGtAmQ04YznFtWU5EYbjlCS8ba8XtU/Mgu9dpzKeKWhiZQdaT206Jnqp75xDi/7EqW7tIdzll3YofmeNRJLyGVgO926VG9d7EQwaaHYMnM6ktDUo4AnM/Zpbx9aTaj2j0sWeVlULze/drzm7//J7zlCixAT8BoDlQzkFMFSD0UEq3rkSFKzstqby4K20Z4V7lGkQdi/iUZ8nUYji/E+CPuRzZvKIs2PXLOJ2imMuxTgdLbBfEW4aB8xEBCGJuUd7j0+mykIdVu2Q9cRUOE/5QI977akxsdB7Stn+5SGGGWuC3Gs+56XNlBvgoo3Mq1/wP02/9XfnIHG82xwdHEZGzG6T35nPt6fjhWApK3AQ7wBkokr1yTxPWvSky445EOBfOCxns0DYO/YEludkwyBkO6ZSoiU53JJFg6JAW9L2YuOnfn/NKHtmio+x/e+mNk4AEYVduioGAiaVC5zlfrCOOBR8e9CpLJNHK0eo+gqlZwk7+yMRsU9/aWdrt5L1/txd+vuDfAwXl+bKyvoIydlpBJD85PlA4cT7dsihzavzWDna+fpmN3na3RqVV1hXl1GBKq2Ma9/KK+gd5hilt/fn5M71E8tRtm6BVuauQa4WNi6hNS6hDhKTMrl9Q+iBgaoZlIgmgcg7X4EmbsEuljauQZZmLkHOv/4FG4gHU8ON0gPLoyIH++N908wqDDrXz4/WL98tsDdvZboEGlrlGuU0zHwvxzY/vHAn2xhsGYctg89OrCsSYkJHGTqT81NbCyDSTzzT6hIcDSSU3DVNQpyt3b0IxZx7ldxx+SAB3WYfNvHyR3vnbJNJFOqYhhX0ELAObdU0Hko3k+SlG+RPPbaiVnV+GF84wePPHMpUlMC4wMki991C28VDrCTIuWZv3NJbGHm7rkp4yFTLxODdmti9j4ZLdOg6LnKkeZDF53kS/fEn3rCXj9ef5VxNfwJNMQQLBALN/PJhZcMTFeFBG7wsYm8bHiJrfCXryCPy8uOkcuEaOkdUiiZdpx+d7TJfa03Rw+V4YrfDe6rvX19XxqmMcf2Ou+gojxnH7p/8g3lkFqcfwP2ROs243o8ZZBrTVhTiVHwXS4m07ndhVxcFVfS2FpK34B9v33l9d65m1wnC/rv2vEFKVJzoboCMvifl1Ni6WN/ni5vHd1e8ks9F3EmSTJ3PGvl/6YZ3J9hxNUVZxaWUfOyWoqqIWqaesDRZsOmI8OxIfrk8sfVE5/XVzfdLK/dtth/NWJzpjRSl7J+hDp89Al2Z/HzPubCOCa9IjMxp3q8pbqdlp9irMwUrPz1XJv4Tfj/78UhOW/90mPWvUdf2Leuw/X/mlW7Djoirlf4dcSKuBhPdd1NySifrauvnHMwdDGXnDZfkqzj4268paS7ohxNHgqQi5XPP5908d/Dnd0/hxcSsy/GyvvLxQwR5l7fXFx4c5M5zi+1uelXfcOP6rK83JpyrmCB6MLC+Jh8ygP7XVNMDVZ6nK1h3Onkn8lICzmkVBOPrqRRbv0w5FUdsit0RBxvPfEU/vU510+f1lgJJ8uZticpqTWMprryBS8Mhikv9s+KklhatZJY6gqPTo+sYZehvmGn4QmFiZJa2CWVgNRqlYC0BZ7gJihRodjaKbfQyTc6IjoxIjQtyosOdT1em7m4u3luvGuIEGVu37igPXt/AjkRur6xfrzJO31eeUDFucTRsrzqBfYqR28y7FJNhEPWaTtdpVPY5zWx1IfISWy+aYPthtraZBLLV9bvFQSpheueU2cmjpMPripE/Ao7nOhnFWDF3p9Je/f+Z9DDsT79RyT2MvsGd21iiIQvWuZbun5C41uC9vX0QEramvgqbVB8n7Y6wf/++6DzEEDS7r19t7wQGtcadDoBT5nLXvn78KX6IJtOYXNJKpOIXpN4Zn0GIZlKqBByt8nZEngu8usdTDVWtfRKpRJz7/hLXhjP00W+sf6W+rkdzt9lb1d5JzqHKwUnzegeT8sliYF2FXDZZ0s+QaX6liF2FWzC5oNvuP8uP15i9yEtXVhXEuJ+WxtA0mrab+wlOWgv5QXlLQAkrbB97VOQoc3CvEUEOpw2geuvV4I2sywUI3ieHnspsr+gghdfXOMAIPv6ED9P6JIzN3NoxRDss8Fi14OuBYCkLZAfkBfDkn5fQWH5adoi0/Vfr6/f/nj/8kIGhZqbVF0HCuUEes/Nvak/zZ3C7ZfauVI9Ms/jI1on2uLS5RZPCRyjCa/0fsTPqLgaV5Dw05Ya4b1GrL8ahvDoKimzFxi4eOXtKvMlLGze2r566KBCl2mANso8WK0OXYvYrTJgGR4dZxms0N+/BMG3uc/P7HDDvkb93hWhM65wwP5ohWtoMnrT4H/P8XljD/30u2urR3NPZXFuT0s5LNjOHjt0o0A+2QV+JTdZ8bMZlz3VChrLkFxpfx5AV3kuTYexXzui8Shpd8na1YarHzOPv6EfHlCqN3IVXCLYtqqOTlQM1qQXdVY0AKkgF8o308OtxlHs4b36V3HZV1IW8wfqm8rb02M86lMjQ66mBvbEnMPtvaiHk0vXsxbzlxp7GrvSDurigy0SsHsAiZ0HSOyN9lA5yz7aA3ANIO9yir0XhKBHh5futI+d7eoZHWu/q1PyTwBxbldslTYsNk27rv54U3D+5CgW/qObq+bHiXGRZQ6Jp4s8x2jj2BVJHiIPERcvOc6DpC14nDTK9ZZ5fOX6wf2nIWphak9u3r96/VFU8F7anTuiQVWiC6Lhr8Z7CuqtBm3HKxWe5nK1fy8zxU+/nAcoynxjCmCaSzkOK6DRpFAyNByoz04FTHOpjYsARVk8IdB7/uKj0dMHWacORk5oZDfUNtQKCffe6YAkH0qc/M/skF0w2Xl1ijoEGEdTLgFx5NiggiAzhgO5fsUt8fwNBrznU52kG+ZLqVuLh7jZgyrndbe4gHRDGNePJ9IL12Iq0enDAAXoOjElJYen4HOIi1XXimfthvach6YKaq6F6uQG1SQxeYwjvBMGVoKI9xFSQLQ97uutotqZD7eZxsaZwssLI8qaNxckzjdtWPlK/nwtO3+JmKNMBygwjI4jFq1deKP0Yw4117BdSLNv++jYOEppuB5qjbuHw38S70r9c68858bRMbjNfXjHxEpJYJGdogHJrWgHG7dJaujmqhbhYCotaia8GBmpGIk5S784rH/IXPdSxTMgPJD8ouLFSIif5N+j04trRCo6aQi/++PjbsLDIE1XP2Ji9WhRfUOJDzFr4dIrBfqn2bqdonGH9nfOzcNFDdcLuZ1mU+tX3WC5V+hXQXx4TIxnkZ+kDZwOUIBu6ULXpK+LyEQTMjzTCFF63FOas+qCOgq135V19Q2dzmNFpIkqqtXpXlb0L3HJ6QSluwIT7YMe9S7vJ9xOcCl8JAjjejURSYnUzScOYyo2o36JwcjkffpmfAQ5I6wolSVsi7H65sWMYTMPXTMZN6WJLEpruczNf7Cazp5SHel/HxRX3Mco/GNvT/51SK2+h1H4Q0dP9d8uLeu7tz4xeK+0eOC2icFjru+PZBZXSenMdIC8M4ROIlE3lh9Loubgsy03KINOtUjHmpGC1l2Sr+T/o5OrC8RsJsIwQN6hI2KSGCsv5f/MMTFabxT0uVZh3cq7C9v2ok/F1dYrzOg3A7rmFCzds3JA9aKZvJioFcmRT6vXyTbOvuBwdnzu6cVahnV2dGBIrJuZUYQRt86Ii2OyW9WLs/TcdS9Srz8d4V1CIEdkOgfzJeijNis2OwxU9A3wafXmOJP0jLqSjtWKVVSAYnZUVOb1sanLYGWBfv7b5T2TNhxdk+b84RdmWe8in7FmGV++5kV1487/Cq5Fx01p1mPilDFw5Xpcr+Ycu9NpzuXTdf7fzr4vuRXAQxA/+Fn7s/YmQTyA58DpLQfn8pk1QeVHwez3xI3Z6nG+4VZiwSej+Y7Lblpq1Kc0eFEknfitm5TzTJOiaQoTTy+sf96r2vu0A82cPZxQlCTvGApsPul37/d4tgXDXjNQNGKvA6hLdTjsr019FPO9F1NOUw5HVwR2DCXJNIVzh2Bu9/1e1d7nzQtTj84qKNp+Zm5n3Co2z1IerLGQOG3rFOnbCXXOXqNaU/XGO38uWvvG+RkPjQyCPe4ltjprrXuDKFnkBtckM7mPIzNWL1fwH9FfTYitC96T2NsQouEf0x/W8czfQNbZ32OwecN5IZrpbrOO533Qim6zSVbIhfzQTPf62jrR8PUvby9fun/j3HxUZlpMRE5TBhqu15Zl/IHUnnd9uz2noCinsKQ0rGVzK6a7uj6nqLquLWl5pT25tiGPUt8U3X1lJaS9vCKvSBOWlka+sZzyeDmVtJvmvwJXkkmxy0nkGwZik/xK9fvEbWSGcZ9xurHhoqFuum6fbgYTcftWbDU7L4P3MuMbg8+savwi3dlY3qwoeBC+9pR0Wc1EvYR0jQ7lTta3Uvri/T3Kwnd0puXmid7NMYxpNwN506Lgfpb1By/hj67RMwaaqeWd5EATNbtCfRG7QTOSv0a2yLAHr6WAHdYy2MRUxS7fQNCBZoNzCjZxLyHko1y89jGQZtnYabn+X0HE5JNL02hne9uF3Rki7dJuS+dIT111kK+zl29UcVpsclSxr7e3U8i/vNGO49g+fa6+juOjw21i2P6uTlxvuwR5aJPhYbmWbbHG8NhcnXSz3FlbtdyadmuKWDjnYuWSnZSTFhbTnzRKUC5KN7FVUepkDRvJKS5oKi/UDuC390o943aCUU5yBO66Sr4xWo+SGOiCLj1Bj1sMg+Q1Dk6qsws32Co2OtKKxyU/gea/OJY5cDcN5makZemnKIAmHVckpuoGHc/pR4aPZ7WaQW4GqhY22sElY4rPeDorOvnRxxfCa1siw6ubIyKr68Ij6ur+HVO1MNXQtLBUVbO0JVhaKJyscSU0ENoH2nMactoGuLk/GzUamQ83uxHO8BNCTBT+aFuZWmm0kftr0E2ZxPDISCfb8coKV0xtqLOlmba8zJGphqXiqbbA7tT04pbkcDUTTwO+2pMVkUPplPy+jKh2GVstI1NzLaXYFsi9FLcGDlkl6ySOKWumgO7Qlvh1nQY8Q3MATfYuHK6xN99fwi6IQyHa+Tn678E+87/n7ABJO1N96x3J41juLLmcV3iyUaA6oINUgYq0c1WSk/4ZgBYtMHzX3OZxUz07MB5rwNQb1H5+qbnl/EK/ZQdjUfniYl83Mtg/1tnJlxxiG+Qf6+TgFw35G2IwGKsBEHEy0y9hdoElkDs6jhwdnE7yokOdh1dmV/YvT451nCWQDGyqF7QNyC8jrfwe3K/Lz8ubQAJxHP7KV/0fqyFps42TuAPbBvNj2EUXruTLIvfSmpEezvXmhYaFLC9z4smmP3834lzgB5LU4aM/EdwsT8jd3MLOzDYx1dzWPNCVRlRYlvZvn/q+7URHch38m8srnl+cD3fysC7wQU16aG9Z+z8KA5LU0Q/6ElAqYUQJIfbv40oq2LPPqOWKO8V66qV4czJ8WA92HiRNkrfmbnjiYuYS0/MnWA0GQNLoF8SPlXfUJ6d11BcBD2O6287WK8bUykRHRtamiZKl7/kKlyLrjs1zMw5TZ7xON3MWnlGJIvk4Klv4Xah2LXbwKNly9g2LdL8jGQXPw932kBtZNKnv8sinbOD8aEPb47H7D12iolPDI6jRDrPYio9T5+PGHRUcdW3HXCN2X4CjuFuo8bFLdbXJVu/0itqS9Uj15m0Wx94+jYeo0U42Ed4qcOW42mFMiYBofkH1JrwPHiWTYz+Ymnza4//crCgsupud/LCwJublVk5OT3Ks3FJp6e0a88D53DzPGXn19ncqZ0suZJsHofLYedlKzL2rui4NlPYvZ2c0Pppzlf8qhrvuz+ee+2loW2KMXAZ7M3zHnyWXO3lKdaT+OSypIPqcMq9JD7m61KTfnvb3IaUy3EXcojY9aPNq7Zzqkj/RdfqhecnA7ZCpGVei03i4IbX/Dj2E1x0akl31EWXqpKuS8pbQ5Q7ldWFoMoRJlcD+HDe5+28dlQMMq4yWYP7Wd6cP4UzfjPyaa0tC3DfTF4wNYS8ncBDGFp9CWxo3ll7V+0t1Jv+9QykvvhyvHaQfskwmbR/9fR2/hRrqWSm8kBRlkUHJ+1p0NUY3SCdwjVR4j0nu3xx6tuMmtbjjYGum81ZJUde+4c5BUF33sWIOgQxKXZN88DuWprqh2qEmtq+cJGXxhGy3tHgv79SE0dSUudQUSxc5QyMFeSODQENjBUUDk9NKz+4RUgu8T03664wKnWpXSENFJVN9JOL8NMREz6gbyehjnuMizLwzYdWUufhQ/3Ux5lqecDPvHFhF5WwuCPJfEysVCDf3zIRVJdKDQwI3REulw808KbBGOr2XELh7Ty9zLTJ6o/x3FNA9CDdijLdXLMFH0i062teHSHTnFZaESsuk8nBS+WUYjrjpSXUrlkNlUDmmOzrs0xw63v+ZcSpY4Wz40uT1vvgQMVxHknDyD6HjSNaJ9IniiYwJZqSQyOfIQhFcF0Gc2EvbRJ7PysguzqbqPBOjFitTKcWe/KSK8opyEr/nl/Way16Xax1yiboTVKMGIyGDQketz9s3t8Hytv6Hj5q31SykvAots/vr6yo7SqDMK9iaMxpZyn7eWp76sl7WG56bw5uWkwgEApxudwHHzZ3v9eI9vbVxkTSsLdKSrhCbFB4Z5Xu/4v6IBUOTUaCEDErDWV/ejdoNC3rLFzkRjM7Pngs5rQ2Qt+i+O+duldQIuUsEwfdBxYNfj4zKkWq6Jr0DI5tqN9AnsHYNYcRBeN8vye8Sq7YadzeMlVFbRkBHeU/zGLWsYQRqbUUtlBTAJyeXqPnwKXP0pjP5SRpvdzoqN2qobSgJGZKM7Eo7eijGahmTq1D1IN/n2JC+kGV2OSUlvaOyMKU/AxncwhyYY2BmaaxrY21pMRwsnieSx8UK8dwxsyYnFlYmxbc35VP7+xqUdu4/uYrIqFKyPsMp7uzorKdjY5tuauXQy/Bm9HtXr+ZGKZUYJiaqlmjmRXYk55IxHcmRhhb+vxJVE8PqEzIy6xMoq8o2Grp6lhrKKlYamVYa1PdqT+VlX5BeeH/L+Kp3I/2QxNLizJTujpzill5YzbVbS3H+WfV5AaltvqdMtZ1s7bS1rJyMDCxsfHA4DA7Dj8NIAew/ANcOsPk+4k53AmDzcMSdHgUwxwHmIuD2f/6dbge3yzj/zrABLqGHAcqdE8C/U5FAr/8yd7txfvHd4oM+/Q5e9wGwG/Ymdck4SHAVL4ZIQTWo10MRGP2KQrecQQpI7kwyLvlStSfVvH3dxqQNq6V5YZSfp9Xlsi8D44RxOpVWu/nOU53Gfpch7ElVYl9XWx5lhTJ24wzYk6jY16NfHhWSq2gif7tKSRPHUreUDnxE1eteJyEvSttUWlaCp10NgfVnSlXZk4phX7dSHuWLq8MihSadxvYBVCdV8A0bWH9MULbxCERG6sB2vrrsK1bXzMbUsyxkFbAsFjrvJIX1fboZMZZjuXMDxi/6j6Kkc6asu1wqvTS0K5odTQvc33WKkNuWE31NJ/2wTZo/1YPKozS6Htpctzzoanro+1FGg5WuD4eC9AlH3bl0AzujT3cT8PCHwPqr+qvaZwp9yIaLgO2DYOy5MrIT3TlevlN6YexUFwXYoht7briT0axkoIadcQevgX6DwRFea7223lhvrXfW+8CHnd9qPayfOh5+/I/bHf47uzel5wLwFODZ+VrR09ipwwflIt4XqmEEj0mSLdrs/b74fY0jeUxzAdbL1hh74IuIUb9f5wnV59y7qim+YvuNf6dK0qEx4tZaMQTMm+yG6M6UQ6CeBoO2uG+PSI5wE+zn7rMzcf6adbBfQGLeLOb9ajAvVLP9X2kD5vCuOmz7jROYH5ZG9B2MVxtA0Xpjrj538+J9aAx/M2354Ao+bwDx3ndkDaiHrv/gIdBXReT/Ni6F88++0VpRCoyfrze8cAdTeQMoWm9KV1EaMO5tIFFTPIdWcFoKCankJ0+ZDX17U2fZEFeJyNoYGj4V+vyGoy0jXfjiV+br3HJd2BTzV+o7J7YlNgCu0i19ftHYd1m3rbkYjTLGyxmQcPVH1gxNDn2wczp6dlh0VdeJIQ/NFpTJZC8wSjkAIwrqj3q2ABd3Q1EjrZ//F4AwVBuFik4tF49NSdWHpoi7Av0+yDOgxOBmtWEGC/sHKWz4+7/OLT/KxInma1/HIJop+W8BJIMRFFOBazukNF1Y+q0KPfp9TQXNT/hgQpmgu9qDV5oy8ZPsogVVQ2ItBbKUJ0pkZRuqE0DWFnbnwUC3NfZ071LRWeQ10ATHcZAeZiHpMzTT3eVzO2HhGJdB3rjb6gSszXDgYMkkpvtaA2ZmI3Mx28vkqNO0N2EZcOZ9Mknj1cHv5hJ/zTvogz6dZ3/ACDFi3EzRpq2w3X30mO79+pdms6lOu+44KxkX9eMuUnWr8n0wEhc5ALWNMywp49WWQbQsZ58OAJ7sIIEhvosrARCgZ9LcNJhywBSYomBcfhHRDLlNBvQSytUQJUCm0nRBRXUFZm7bwuwYyYEF7JsYYiany9ELeA23wo7gXw8EGWiKartFhBSZGmy07zkWoxKVxUTUpWnS2EVV/TQt+LZHh+5A0Ji+PwJ4+wgM/wrpfXGmX3OGeJAzv8IsAr25DFgVK9tDx9NInbG4zQ6YYreaeLNAQNqe53JAHpdyxTrEV9gRgATECoNqkRCRGy0bvCjBvkLxZMn8U0beKCekbW2xB0QDQT9pkVExzXMZpx8E5HPBSe39gCqorOwYLH36yQ8+oceTIZhicfSk4ro674xlT3Ws2YcE27Yo0oK9Zu0YsRz0ebuQk9vAm2wv0swoykXvxCw4cTbe0TpA8kOMey4mUCYZg6CgPzI4g2OmYA3W6WFrUjCkL1NINlvaIn+NECpTC/SgoOLl8GsRIZ42569XxE8K4I8xXrvlQbGDSe4zH3wPHkms46fVaY8ek8lLTl9vCMj2z+0QIQLRVaYBNVoDBsa1UKTd0Y1gasyYqyaEEJipnkgW1muBkN0sxS9iibmmmF3KLMTJi8b3MxwLU+Nbh/ALa6KtcWRNOAQJWgZHn2LmnmyutFYmWp9PMSIn7SSKZxP75TOch/p/TrBYtxr1o/79VDr1XfolAECOSg6A7D+uof81wR71vwj1/vF2Hv7oXz+j9K07fHQDJDg436PKZ88Nf5D1UrdhA6tA2X/ynbE0T5FSlcBTeA1fIYWfXNO+sHLuf3tONfjAlVASKeQhz/mIx4yKeXQPww5Yjp+0BDaA3XRhgSgkGxg2vkGukxWi54KDU1ZWYx4XtcRupiXfLbvU9OR8QhSWpdcpwJUjUJCMmM16molVc1ZazfukWh2ydgYVKM3SrpotfbaW1bXWPFSIn1tt9+ADfyRFJGUFcu/7awXrjcNk7NpiAoE1GBKmAyt9iUHPxfFlPb6v712pZAx6hJbARsoD7rTzLrWD9mpzYpHEUJaTFATEoWBWjRRIlT7YrYR2Dq09aVWIWVTyrs7HooF3uRl7q9t4IMdSJJi/8I4UvofwHD6CgeL/2xXzhFd8YZ8JcZ97pR1B9kvL2V7sBhqpNxoFJWnwJ9c24bCHoHL4j2BNClmO/k+IyyhH4U7rxGyWyuYxFkmkxk9ucpadw4JtNLysKBnxUkEoqHqlE9XOKyg/rmY79fgPElYjQzOziRICBNCl/Ylsw7Cw8atEDEt5TmguZPuOQUs31n5eTmBsQQE6K1FVy8ObfZ7qvbUp1O+CimrTgkp160Qk2IpQgWqCxGXEskQKeBMb1Q7rBVphIWz4KoFfMudnS7rs6TKi6G9DVUBZPsvEGyWg+pTeQ/RwHuL/rCA0qqRILEy9CgAvi72SbQGT8gEh82Zts9AGYb6GZzWjIi0hTe3L4QQ7lNYYZ4i2gO3YjlXD4egFMx37MYmZBoWwYv3zTGPavytT5RYtJKwUBDy2KoQwfFhZqqtquCjRqNk3fB7C9gkQwA4lbxrC3qpTv0wpBKe+U0dg0X2OYohvowKTDU8xEWpy0vipm8rcgqa9+vgvy+3olKPa+xaEDP+iJ7lQcR0SdumvnO9WhXKn/AtDNriXblpkvGEtM1Pa6ldmJetqE1AFNXM5LzjWln6r3KjB014pApBSM5eGTNjfjQu4oKLWSRq6qkXzdtx0kxe2zg0cbng6tYUGBSX6UgZUp/BaYdlM2RxKrqWGxYu2Qp3oUm4L6TBMjoZMRT4kNiJc4Utk72E4NxnrtNFYvRFzOoAcyA6pUKAopY2GNCH75CpL4kiTJEZZmmtfYnQJmpT83MsRKUxoOEDGgej6YnQ8Yr+IeKN+ilsmsOdg3ewS5GPewJShrUoM6+5EDLJCopbhG/dzHWpZWyyHnHbqTmklTZOCYkhkd9fHYVcuKwbVr/MAgNL7OVoSRoW+uls4N0H8YXEGZKnVWT5HhpaZK15lNsRlWahY60SBtTCLwUizxKfo2LTsmwANipkuK8p8WLmJX57NUaIswftNySFSaKjMsl3QNjkornfkV7p6OdDSca7vXKBfO2jwz7jifaiglbJUKBeMBnYo528PCyHeW9H9nB1w5fTQqB5PjIS+zYVSxMkfnKsp2LE1jICVlMUJNOVarpa1YoFDSZyyjCGklDj2kfJYw0P9C7jU83qj4+Jn4DLP1LsQGUd6XJDXaTFnsSb+0GFFe68cqtDlUWhJv5yH6aXx4cmnG+sW8pNzSWIkUotyVlGb2V5sjuKg8pjO27en0UlsI2y/n2w833k+ZngfvH+AXV/SyL/MiXrnE2hOx//IXANZG1Uh0znMlN+ZUh3Vg86/7j1xNRfQ8+ZpAL+zGk0QUvgiec55lmOrAkdUB9RMVjM9M6FqVdBXZPlk9ahly6PV4MuEQZBYtJ3Q7++/6P3E8i4sKod/Ls+geoqsnzEcvOYfnlihnSKk/WqYUfdJ3026mb5HHq5JMCvX6HBxl5HT1/HhmZXwgj8pCpLVb7SzIsZuZsjWAElBOfv5RRyoJWTko7ycdKrQrjwdVyLF0uXl8461q8AadVotRIR2AByF3hzWKvvVLacUVilFgexlZS/5RbSuxxxlCSzoHRuU/+HH35SlAjT8IdhfFIu4Cy2FUZiWU6tNueB3hgnLXBM3frd2Vc9TKKpIfYPS98z3BODl9GwlMJSvXk8OIZZ7OqTDUgfNyCxYYtVw6FfRvHSnHp8QEeqyB1lWqMME6vmAsqd36zZbeYMMY3+NU7hTUCBx3nPraQx48BeJhDeujGhEL0YVYsEusb7E5q3M0Mfx1yFJ0wOmlu2WZibtv9jCrZBOdJLGeFHCOYqPC2iKbk6tlPQgNspCucsNX0iXRsF4H770mnWiWyeYJMN8A785GlzYWpmdfM7gCWWOQpiTzZ48tBUZF9N5wMBV7kjeV/RQ7MeFdZKr5hVoQKf4rWABG4taXjNDuerAmEhinHrW/rV6RAJffKe/FU+PsLf3QKKKuDFMoDY5xuISAx94bKX7sXuMW+cwdD7oJT+I0dUFZ4Vy41G/Qp09KZIZI3sdZ0mTXzBCnBp3sxS9LO9mXbj0atVH9eTPdTQcbtBAyTOl0+mGMOYCA3MRy/4iD/LlKrXXzGjc/vFO+I+C4x7tr7y8e/0ykp3ncvyniLBMsj6YRJF78GhKtz/M2fZzW1edFNlLdapr2k8q2FG53eiL1xNHDuL+61tL5X5x3vu4H/skRsY9pZfzfeI3R58avC9E0Q5Rek609lNqGdPaKZZGCDk9c5na2dl75eA8FP/jFGmSm51iVqi/Un8+M3xeuf2/fEg3C2Tejq/vJ084rWK+yBMNoiT9WnCZLrkfu8ZIuj3Ec8sUxAgfxAgfxBpZkR0mWLU8LEjiahGMdxKDPxgHoa0KWfZLUKSzSf2xAi1XEhjgjMnvx84xMm6hI/e0N71QmQDvDs34gS1WqV2HJioCV+ymv3bq12yheutxONQeKT3EIFaOjWvduT/b1pkh2uO6G6ao86+phznMvaVFHBf78poZlayoPcQGTiN2kuSrd4WTM08lTtlkIH6zRkar7jrSv4osBiyBWT1v60Q4+5DlPgzBrHNRA98csFzCZ1eLzb3yTAn73rXj5MK72pdytxSWBam+iists1n2qvkcvAK0s0Uy82NltlmPXJlx/5BnnEM8zu6XODHZhQRyY5L7FfBiXcIzSI4U0fDRzXC31y3Cp+xmJqbwY3iAF0uWcyZGCmol3YWHCSKOb0mF0U7dcqmZbJo0HHUt+xwwgYn+dDzNA8dJYIAavDHB/RCmLckMwIhi0BCXDzeocL0ZLWhTNtyrKWPWP8cCh2hit5AmEGuWUIsND8rAfsguq7R1eBS1v95epw8/XThAWH9wDGtiBo8D05HFHS3XWeDGcetzWj7EerlEXFFRre2IG4FbMW2AkNaoo9cN7oPnj5pJ9yZkKZmZXma1fNpbRRZr2xPW0oQplGyG/QXfrJX2n7/YqocV0yqNkB2NmN+5AbfQWPs4uh3O0vZWWi7kidXEr0tLnS1aMMz2kkJzusqNaP0tRrCSOk2FSIkUvZNyiJ3ocs7+fKOYIUdjvBtq1Kgd/cPaXpEjd9gg3Lfvcde+w7Fz/IUzOJsroZtvdssg3P9hROToDLb2hmvnWjU3wgTphRlLlnI/cs3U5nm60m3Wq9bMiemavoAqolJlN/lliZXjpI1cf7UCSEgallMElilDZS9UkCzI14Vt22uTWl0p0RP5sLRNEh3/qFcH9z/xAJ6pclLoUiEjlE0G2SNqWrUlVJ1t2CYdq+5J7mJDrF/Tqf7F2kJFDK0A13aGWhIFiVWlIncPBoVgq1G1GlXPGms9vCGbpW5c9w/gBu6/m1fx31dcXLT6qyUx0uy36B3a8MzpwoMr1++z2a+aVCMjWlUuL2/IMmvaTPcp3Edvfoi7V5GobB46ooWiqXevfNmDOF2ZjGYdmzJdNIYcL9SPNYzMd8m+oE67/9+PDDcA+oJnaP980OjHqf13tOgB+Lcu1nf9P/9/2m8exGkcvG8ACtgfdcgGwMGVcz4z+02Q4c1+NUoFK+q/rf9qn9LZFSjzraSZibjuiZg/hVSIsL6goC+TGmRCs5htVRNuFZItqHJYw/YejwOG4QNfqKAZ+bABqcDrOrg+KKxzTk0u5jNY45RVONZZ7XIilzqh+dvQUpG09AzN0oEQzsOKk7qmDLWM2RlJZSE4YmttfwCkrWyJi23xxI2ebw3OefZzjcKSV7p4Ce38dBaCxtzCOb/EtUVVD3MnWxTzuBv90QrRj6MxPUXPDKVTnvfM4zd1+PQ67ZnBf4YrrY/K6ijzk0NZfdS6w1FnpNJZyUunpZRfT0PBn9c2zPPhKOOQ2AZ3Znx3amzgGeZ072n69dl4Erdi5dldja9f6vQXMft5rSkRUwln/VbNfMlzuAvZLHiNGjVjUegkyoJ/s+RPa1h5/5U7TQX0e4b+vOl2rrRJ0TyOGDWPmvotHpWpowfnZ0HousdlU2G/aYgZG4xtnhexPTWfsoFlgU6AlUP0RxuQo4795YMJuRCbxjwWyIYsYrB/SP9cQrV5Xopti2wJWZBF4+tX1vqrH5DtjvOTJhM5Ya9iNim8siELQGy2qltc5/VLy94lfDcWUE3kx4qhHpMy1qRNbqDeDsC6nu5NT2Vd+HNOoxoc7z3hfZd2L+72CSXLU21VQRWKdiiCvzE9Rg+tfk91ZvJbkLBZbRDg4Mq8CwDzMUQnlfa294IsPA9S2dOlyosrTXYs4qzgpCHAv5hAMoCo2uQk6eovgVP96axV+drL8t9MKyjt0xqT6WkDyhVl9jmctuCKs2PDUdePpup09QerzSOA+wA0DcKmchoMh75pcGwuKog+u9OQpLyYhiJUEpeVg3PZMxKDJAVZhDDh4uEpkqfwnoRnJoZyIwhCZrVAFETWbZAoBJ+jhozbeW4h4oQgSxQimCxQzzVcxPPnk26wIAbJ+pVL8964P8W+KwB3ECPQK/ESeCEYjAGhnlSYBAQByMATPuS/cn2OyLvEqTJOBCTx9hTZDiVqtG62Vg14PAiboqyCkpqWuT2ohdajjBk8dK9MfGAH1axMokmOnKRRi6wAJHPBg4QLISsGWRg5BBGChCBajOKM5VizYMSELScmZOJYKw/4bAAX7WkBpICg8BDn65rT83Cc3L+f2ySjKCtfE9mhBmXBhif3L6C6Rk3wBxC4h6ExY8GKDTsOnDC4YOFwO4YHLz78BAgSIkyEKDwx4iQcJ0nKgfDKZ0iTIUvOkj5FZ8JuNSM1Gh7txlXXZ8CQEWMmTJkxZ8GSFWs2bNmxdzb8J4IzF67cuPPgyYs3H778+AsopB75ClxU76VC5ajaDOktlBJ35KkppjpQpgHFsgfFrN2wr774ptuYDevOChSkUrArQly2adtV12w5EuqGHdeNC/NBlQN79oV77a1ikSJEiUZA1ClGLBKyOAniJUrySrJUKdJkSDenS5ZM2XK88Q7DTTTnisUt990u1jpeJ0yYNGPWiinTVhVx/wjEAXGCS2AeXIAwEBcoBe8hLISDuKFjEA/EC/FB/JAAJAgJQcKQCCQK4SExSBySgI5DkpAUdAI6CZ1iSiBGyL8WR4URUkjhitum8WKIgbzWCRsqoo+SU2OkoqER/D3o1UcjZIjyJ8BEOdXnJ6rUlBHeW2IrbmpiakqUwsZsrxOydRNG0KF+EcuIiLAAJ4GwuA4Ji6uRRMcnxcg6OYyjY4ghKsGcGkLelyyu/HkDdfxrq1BEYjuBjotI5jCPBviaPaAA7+yYGCGGuhJ5GFhxAABrc/AeB8CB9mnS2M7QwBkwAWFgZ6AJLiich1kuTXlJQQxAnwGzkLmWrBi3TJuFuZurn6T7gjsaKUvyCOFro32GX0hVaXF+TqFifUwVBcVUleStKSF0Zpi9hoCYnU1UpbjFkuhvpSp8WfOCbTliuz1REqQtdm4MGzNKHNqKJ4S4xKmvfEqYe2PsDQz6wASWlekMDbhWeyf0BKC4Cb8pWZGr+Ak7YqhgnP8RrYQJPfzImpwi0LkO3ke04if8qGCb/9FrGDE4cngobl14KA4=') format('woff2');
          unicode-range: U+0000-00FF, U+0131, U+0152-0153, U+02BB-02BC, U+02C6, U+02DA, U+02DC, U+2000-206F, U+2074, U+20AC, U+2122, U+2191, U+2193, U+2212, U+2215, U+FEFF, U+FFFD;
      }

      @font-face {
        font-family: 'Roboto';
        font-weight: bold;
        font-style: normal;
        font-display: auto;
        src: local('Roboto Bold'), local('Roboto-Bold'),
          url('data:application/font-woff2;charset=utf-8;base64,d09GMgABAAAAAD50ABEAAAAAjZwAAD4SAAEAAAAAAAAAAAAAAAAAAAAAAAAAAAAAGjobmk4cg0oGYACCBAhICYM8EQwKgdhcgcALC4NyAAE2AiQDh1QEIAWEageGfAyCKRstfgfYNo0G2u1AhCddVj4KgY2DDcR7zMhALRV0/2X//58S6Bg7aDtYmMgIJLaKxkKneetD84Vb4Ra6Luoeq1pO+Jy0PLHURYbIWPkSu0CNxcLM6hFZ85jRaSM0ZHWTX+T3P6rQmnRU6V1/deMv537KIQ5pseeGIZiDN/2wZlKz7SU7od0ivr8gMCpDd3DyO/WQOTvhLtWm3vbuOwPbRv4kJy8Pkd1Tr6qrZ3b3REQiosusFFIohWZ0lxF/hufn1vvbiB4MAckNtBGBMWJUbCNqDMYY2SNKEJEYmYKSOdoipUSPFoxEoQ3Mu7MO5/J+hMJWTT0B2wJeIUmBrNz/6urfK7LQkizjmGc8u/xHD2g3xFV+FcCiyTnIRbc/9cc+2HOPLgMTKDruEPqvZXv9/8xelvhLAbIwYykk2SUjsCu3kApFrVLUyFPgghs/3asOYIGRLuOsYCs82P6Z6y5rtoVlY6PKDL3Pfjjo1NwmzULFKpkjQoj2MkmkJY5IDoTk8u8TcPpnTHYM1sacYijZUJMl/+c/XevPRgZfapQG8BOYWPU70mnNSJadzO5a9j93gFR+9d3uynSRKXESH7BhGinXSU7RPEELWFRIkuGAH/4//ZnSlwH42wsM1RZNgIo2qdMW953ReAno7zXeCUaT8VLFIhCDUl9awYxnQsm1Sh3kTP8c0OHh4YF0kAPV+/s1K7VV//dPDy79XVZELsIdoENhrs6dUL9f/2y6/++eZLonU+memapMspTJcGYxs0Q5ZkeggJIs5gjRAqozYtWxEO5q1dYpFNKdMOf/v6pZ+y4pUpGH879z56r8pGacK7troEdwHgWQ1AwgTQqkU5THIe3qf4h7iA/pnAEcQiqacZcqb+ey29Bt06/Zfn5siEEcmTfWEhGvtN+zXKkecCu4FUSQtcarE0LrltL+kPRluNK9/9vOa0CxoAHKyY59F68nfJ3dMi1H1X4Bhl/7o64OBg6yCfLWNpgdP0AgMMD8gIVBgACJBwHmUaQDsdMu2yuIn/ji2SB+6rNqgfhZh4CAOATAY8u5M0/2CHAC1hyCMZW46+J+Je29dguFYhQjVMKkNba+Nt/Gwzz5c/E2n+J5IvFpniGZ1JayKCuKO59tyCZSyOqkSDNq9iXZIt3TrNaIZF8bL59PLBV3PawDkhgJ2WL84yBECOx48EI56bQzzjrnIkVYKnBUqcPTpE2HLhJT5qzYsEVmj4rGiTNXKVKlYUqXIUu2HLnyFCtVplyFa8yAWh06dek2YNCQYTfdMm7SjEVLVqza8BhEvSkIeMI0naJNRC0REFScFCH3gZB92cn0KKRInTDjXiJ0gGiQmCGjRNu3zbF9tHY5m1RKelKlYUqXkWropUZNmrVoTbV3oEOnLt0GDRl2063U3faNGDWWGm/XZJim9fI+WIP1DcSpidZrH4Kh4pc5jo16r+B7R7ND2r1Qi4BQLIT3B0tvu4QToin2jXFqWUhBEguRmaG2Ot2pDgIfYfoEEzab3KFAAK+DPn/FJ7ewU+gDjcZ1N1SrKRbFDomnxbMthNAuIpCYodR5Q/sQOkinLt2mUzOQFi1ZsWrD42jIUhV4EDpENEjMULTr0KlLt+nnEUwJo1LmRJBxmwO5TYMwZNhNt6KWiGGDLJWQsWzNej1Zhw4dOnRYxe+Ak6sHtY+cegWOr236fdXpIxjTPnBqHySzV/hxt4mPMP4W6RNi2j77HqO2zx1KSN0S+0dmtdqacKdxj1pNuj8+iGUoiDLFB4VQBSIhMVuTY6CEkw6JccKjfQkdpFOX7tRgDEOG3XQrTGt9iPx32NmBAM4/VydJDDDxj0xve6dSb8sO+quOHq2T++11me4aZU9Lfe0bShf6WEYBw2sQMhpPHu/nHx+th5/Qb63yZswiJxbLtt7P3T62Lq9twJcp/5Fz9D9S830LAmGP7pHK/8XJ/3lvmGnNLPLV3EtHODPrntzQ7d6k2moPR/cxidKB9Fhve9zduycFNNFhtQQJNdNmn6h++T2CHSeUX7VALb0rTcXkchlR6wY8kA00JQS21U9gU9mnzpxzPl9XwJUmt5X/Hl8K65qq3KHKA+yzN2fnziv46L/lPkaHEq752pTPm2e+SaipPCcW+Vowv+Dwln3jj/in5zULGhRx3a/WQdjj1yC68RpKazfs9lC/10ANsZT7Yjrd6ppGZbQwuMYD9YyLDfOs3veoV8h/a6owPLUGA9fpUd332LtLuSZLeqV3DZZH51u4ebZEnuvYzLMznT6I4RN2UGA+CkFSGKHycCedhSBPBRd1OseexgiOI4FKMg+WYsOONHsqi/ZsyqFzcUKKDKdlueaC62ppa9DKQLtuRANusXiF5JHN4NbtLVrjYN1jzmDU4yGiRJRIYAkGCnOKHneaCjpDIWcpGwXK7SLloUhFYClEhQpTp3w0KDc8FadJxWhRJG3KS4cKMKbsTCgHgjiWbi1OjEjbQiCDwtlRDvYUhUa50KkQZ8rFRfLLgGEMwYKy5WFTXA5S6hrIdTW41RrJKw9mZwg+pkM3TgPBCINugRunXCYoh0nKZYYFumiJLluG15qeqDWiEtalxCvPiKicRJAIesIEiYoQosJOSnZ4MOdBYRSoKCyFwVEYNcEvYS1uwkWOERQRIDwECeKlSSBmJCHZCJwgPDgKKMSB8nIUbBIeECfh9PgwIEWEJOwSJl42TJUqME24CA/mYCAQgTNMumsMm+SEx2mqojDTFDKTLegfC0TkJIJEmAgSYSJsC76TOmwJHlaeU1o5bCQhtj9ixsHvOL52Q3cZj1rPHTTeLDqFVBMM20DtNqJFyoTj3hS1FEId+DvFE2XInoW6CPX51vtnUdmG6S90POwD0+oyQAN/N9QEJFcEaAJunx0HpBOIwjGxrLzXk5z+FUVBIA8gXKkHDPuq/LbAmbLwFozF/j1Kkm1q7Z20ZtrUlJ3MjURhN+E0SQjEJw10sAo/ywDf+0S0Afc908Jtz64d+w4ceu+DjzrcxOLP9ZEEUaJ99sVX33z3AwxEmBSg1YZ5FxvQb+1YIFZazm7v8XmzO8u8RhcDawH2BKwMsOu+hwWggen/CvwBThkrE6BBdwHUtp0FWBn8cF3LxdMCUIRP3tbQDou9WgtI9DdKQc67OZNP8/nKiZ6Lng+9+NzO47ybT+eH8+38dj6XH1+nu/C/v3//L38Jomi1e2U7abG5mftDfjDf/GwS0x/lXblXiqbwffzh9/d/3/9l7vXk64nXt/NwHsr9mZWbcm0uz36Ps2/ufv0DvfEOxOyC1rWn0R+W3EJJp2lrElwALD5zI5xV0A2Dp7YlXLmQnUV4EHMsmgkO4/iHb8AAnia/J3rWh/0D3Xh4xt8rTrZ8Ke15uHXgkDk8evDkYIdgax38kBP4IhlLVTmO4+U5jhN+OJwRFlo7LXKJjzWGruWxXPRGLJLSpvdFte4QjkECu8koxk8HkyeNp/t3ioedJ+/LoYwEtSckr2QtB7RHQTslq+pQxacNzR+PhUhRJ1pt2eoGGxMxEs/WY3y3ElWLWuZRnOlgL9ozzVBjTykBXwTn1s97jboVpFlgLqpUF/AOvcPORIJfVVmd3z/ENFg0wLMXbXiYrnLNHK/lnkzpNeuqAXLXFL5nSphNBOO/j7xxIcHE6BDpZHE2NElnxohUNDOmoj/idHRlpdd4yr/gPvBg/xh9gg6sDN8Da0AXKYqQNj7yKMrFxrbEJpyfUVccxsitDDTsaIHJXNahmikQ8hEHpx/zaF6M3rFiZJ1hZbucuOUvi9bhPLSL9wXcciF7BiVUdgXiCo3i28jOjpwh2yyroHSrf3tSzVhPDza1hg5SsxCcUdTQ1PL2QtO5TnltdJVySvlGPTGCOCEGo4zaGpqliVOZNbK0Tp6LjKdGKkHFzUc4aW8GpypR9jqjOlUpHYM1XjltT8v22y1TG9pUVO7m3teUHozSnXW9SpytJNXK0OaE5lpZntqN9MRb00hpxeWlFoOhxpRCeEUbMxohjdI1y+w7hNMlFZRuKKUVrc/oecOtPtG0LxTPlShVZr/qj3l7d23Y8nftBDgsD2iqximFKKOExZxr5InOLHqCslSTUDWHiZqoBYrSxiZJHDNjYHrZAAXkOciYUUIgygFcrRoIIccMtUuIlPMd1rkUWLAjMowbEDvnnWyuEanG8w9aNs2XDCaA9qKR1vWFKfaAkTax16uX4q172GVNIxj8xWnpwr9UYazPBSYTDuytjJ6rs3YUiaW2C93EM8oGuVwZ7gadhqj1TLuuGzXLypEVcpEy6lFQKEdn5EQZ/YAxF627IRa8J4pc1XDP6H1Z7zJ0taPg7QRVud7GI+LGCg4WXDUkQ2Pjuu9LnnSb8gSo5lym5HV39zF2FAsgR7ply2qsvEfCsArlWiqWwEXn3KqcErqGzgMMlBHdtvWfi7G+FrQS8gREfZbjseQy3sjMjBmvrFk5Foh3rNv4xzjKGTco5L/QysDe9bbGN65FvvFp7FB0eMiZIjtcwWqhWWJ02J3A2B2ka38CNBOR0hvaR+/on+oL3RLGmaBOWFm8YKHjKfhmK4OwyLmfTB5LvfyqVSHzO6HZ62zznL6G5udqvNtpfmfoQuWaZDWRp9WGGDba12RS7zpK4ibUFfrpQ5x95AwQFlJfI+cmC4D2tu7pcwUQLXNnWlyD/kty2fGhwlUY2BIryBuRWck9a6kceP+ZwCjx0pFexx6q4HtKDczJojnClvVH2tnVOxiokxPZI+8rnijQww3HND1wkWQ5Lap0oZLiSLBiHFuBrwUga1iQ7KfKurJ75TEr0y+tNrr7/RhnRNccqjk7IKdOBAHdfNXOTb3KU53xTngxfb4Hck2uS7yRi9FHJj9bUkWim4lLJ1iN5VRxA/c7mLDggdrekVt9Odw9RcN4QXrc1vPhBnTFLGCaCIBITuxooNwT4hoNxQ5NKlhl2lL+ZzUHAVfNJyJqvpNDOEw5jyMl4LaIxqWDNLQQCNKR2QGOXeoXo9Cossgw/28MGQ5DPIy1T0FPTZKKq3qmNN2IMUxEKDUlH8r5pls1GZkmRCucM1EiFMETh/o77mNIABXpNAdqLUxdG9xIjKJIh2gu4YW7Hxakxx/Yuk3JdbVFJxQaYg1vVkD4g5uashExcuA6uNjU35HOJQxrfcgsSvaBn1RBrvNWZMJrMtTbEl9jos/s536bcDpyOAIOO3tlQvJcQEykqxvob/1IUX+INk6wa69CsUo2sEzihBeSO474n54xnUs2IaNZ5BEK90jreOupQmTgfvaaPBH6kYYEbbQIEw+EYtSsadSgTT4BTubZlD8d+NMtVnAosQrHrtoYOyjF7uKYzOdL6dyA3GwSCxPaSTw30SpsvxnIBSSgZZvFgwsXrPC6VtpCMZEMOWifuw/Pa0K5BC97KyNAcmQi4NaGeNNFLaGwekgaBcxtXNsA0Rh3utUYhM5rDO40YgeGgGuW5YZqW4AEBUWpPCqUKHZVvaSKJekp/jsQkXNnL+wZUFzFciAMOLkS+MYVJw/HsDT4AEpyaTY2rsa4ZcbQbpsQVtwu9mJ1lZLHck9e2X+fm+JJCJdaRm+VAhOLlYCbD04Eu/4beBgpIxAxuWWshsM2ZZqZww6VVIFf6hca0duB3vNIy0rVxxKX0Z9D6DeysymakCTB0CjkuCJZZEZlHPyXd8ZdgOKo4pKdGKesYqNDp4stxDm6L4GIVZ+4sOb+12CzYKj3vX9vANRXkxAyfYjbu2OsY1PRlghG5GnsCZ9nv5LhhUQLxuhEZDBI4UFcY3Ec/LWqG/hWhisNWcsyJeoKZN2fqg0RGBt5pckLyckU1KaSzcFWsDkw/U291S8T4FiIhP0KT0hkrHEEh5ZMHYrRtiiz2RF5jmwjR/ImMSZzrZLrQDEfjtfYS4Fb6SVBV2IMmCRodWjsdGNm7QuYSsBIya9Zb71ufDdnvEzHjFdhwbFATyhyHgssN/N8o9YM5EqRb8Abj9ddGxf+8fTFVWOvkMLJJILDiqCtE6PWpxgTxrK9KkCSbeJKVhwtV096ZofPueMUl+o5YLEGhcAf8mW4GVbsmoGsJhwIFtQPoqtnNd2SS9T5u/l3fqlYf5l/63UuG0RhB5dtLc3uyPrvAXRWYWRI1jb+lRzWaWuqrW5Cn5qNwLJhmaOSzuxnS1MPQrH4K2/MD48oUCBBcY0aDnmi3hQF2iKHXELFuXbhyXg6iSeduWtCi4/vjK7FdUbAEIiWAJo2vOiRReOcXQtfq+GliGw/88FE5sn8auT1lCVZZLmuunECm/Lj0fGj3PLDUJ7Qjm3xzLR3QnO0YzxIAg/yhAACQmkHoi/wtmZTgdS/2dO3IqeAb31uYkgyfR+eLFNL2hC5xjWMt2ko0R8xgOQMGBGtxRI36j/EPTf+MLaStrBt+xGmfGHTFqo+tdED3/O+WLibLfBK1T0fQoyjP/LEvK2DQ84ZkDPcumT0E0zuSIWrMZ9EpRgaNFUkYrlUqr0Wsin6dGX9yXmjzFPeuC/zr00Qrg1LobedkJLEbjcHsWbIoEk0HH/W/f/ee935JxanGU/IbvVktZL7FVua2xObG9YMP51cj7aNjT7B9donLLHZr/cwsR7RZFtHuq25g9MH12t2/gFqGU7tq6u3hGZrZh4ee/39H0wMIzGA6k0PZ/tawexqzs3vaswlpnc15OZ1N+aMsWkZERn6JB1TLX0SXs2QqC+TcjG9pzEnr7s+n8jsaMwv6GrKHIOrESxUL6WbaxkSGYZEXehrjpl8ZHiOWbpJujejo8xPz55UQW5fXxtqWJoo7O5JDbX+Xw4fkfNdMrnnyS+iKaXWf/kxfHMP4UfXkDazpJr5OoQEQagoM4cwc+UmeYIXiYTXMbWKFMQFSxYPn14TjbfairvxXidLW62qMLDhnoLMxbrp4lC1inStfZX4YvgzpJv65tW6L7pZmmoVuQENIzAM7nz9bGFY+BMa/wmXWgV7jjxGntSg4gdUE1D0KZSnwiX8kC51mauaMSjXf7w6EH3e86I/m38FqiKALSAdJXErqMxSTs8gDop9/RXMgpDgNzK1/2P3sEKXc43pFBMCnWJs5GRHJDjZyd1P2MAwL2ygDMNpCv/pHn34qQE7wav0S/P5T3XYCfTxQY9Gfx+367Bmjz63zsAA5yaonYjB0KgBB7QNGTxpe2b9m5s//QbB3T3EyYPBDJFNS3y2k1D85t+N6aDQV+klpvRwJ7FiamWIf7AT1c+dTg6lkTDhlwaee6ftsD2f9Ipr8ZC/dD62J3ZSfG/vqfDWCMb2ki/NNzKI9vTTtULN+hNNe02aGE0K7+DJL2MnTmFzDGBo09wH5LeKR4Zy6j6qkUsH0G5u9MsXl8pT3wQkT8DjpTlpQV5UD/+cqwlxKQzfb7eC1XBjHyTvwT5Mi/ZERPWOvhJ4mXdp6/WVvG1xXR6/930BljPPwd5jkzBiB7UwrN7XObwoKiai0MXoGL8cjl9JzmhmbR+B1U+9EODfQFf0V47vi5vkeD3D9WYiLr7fT4mu6NcQcPvH80dr/z5FYo1dg8Oc6cEMN+fAMDeXgGCpZxRHH1sbR0+qg6N/I9U/STHchBFSPrHD+SY/4cOr1JyCV/nxfKArMMi/xozPBBx9SpB1oyZehKKY4tA6F4fQ6tiYoAo3dnaqv8acGG45+LAJFhPR89hPPEy8UeD03SCjeRHVsOAD8wqEiIrQRnMMmwZqNb3U266bUmmQlSw0+nljZW3v4R2KWZmLk7W5GZHbXUtS2ZBmn0ezD2ijiP8AuQXbinH//R3es08gyRh5ZtcV1XxD3RdsTAazmZH5Xvr7yvpclqpkLXr8OlsXko6Pxk1cuNflx70r4K6ZrEkePKEvffLa7IKiP2fE2lA1jwwP6u1gxocfP3G9P1/3agR3imGGuZIDRdL67OOgsxGJ9xI1r8rze57XxWyxRGSPsXQx0kFDaEIyYGP94RKcnwoMrnc/GSqR1Ba/wrPxA+KKy4QCor0c5xZgQqsvN+G9nuH2CStlVoVbyH11PiCmF0tyXCnWFWof+oXlE/0iz53DTMwqK1mH3oQc5j2pzM5I5Eol/JSPjyt0tuk8MHzQrHmxaxRwRY48LGTd2oIeWbwcfterqbMZo8dsPFoCbKyFL/VOetRdK1mPLC+JgS8ZsdMraI2+ae12OmBgRLKxUgNa9XxapCPcehsu91384AQqISMi9lrNFth03uraa20jEH4KvtCOsFUEjzBIjPHZ8pYkS3mLicdHKyX/iCX/KfvS2quI3B1of0Mh0NHb3d47KliRRKhqqW2/ByUpA+EvwxBMjOFZb/OuT5eP2rY8orPoJpaoF1rUCJ0F2FgX8qS6xUq0F8RStaS68obkOtqiwSMnUkZHx7+SJ4rHx8+b224Ob5QbivcMD0p0VRmAZeJGpYl4d5B4d6XJ+kXwf8P7ivKGfbBJeNXwrbK87hBsErsANHbnjXrjvzFpz3PXT3yHs3/mjUkI9Qu8nBICoaxsJ4cfpshH0o5GRltx/xI1iCavC388dv07JgUT3VopTZpJxuNt+Q3QcM7PYfHh3r6RUXFHnmo2iZQYmpoXTfFH2tvo1Jv/+lZd/8Jg/pMi73U5JDwkjm5OyHPNOvvXfO9t+4jU+udW1KWCR7kXjtCBMfY+5o0joyPyIze/1F+0YGONfTx3DP63rmAH8/IT+RnJcb/hXPe1q/yEGwmWMoMsDZlSloW6FdTIa8R7XhjHUuBfXahNhfkunue14xZAcP9xO9N/G/nNsWW574Wz6O/CcB7YUsaRfDoFrZBPlHpbi1RCls8mSWns08sjCusCgm/xi1GniWzaWB5gx+a9YgGOI9YJ4LFOn2K/cAYF5tVr9a/yI4XyT0si6rvmts+tr9Tdtk5rgKv5/NeQuJzd/HsUTlNkUzXTL7K1Zmk4p/PP8CeQpmNm7kgm2RprY1wialZpqXP7c0OPwLWzloJCc3qB6jW3g57wlQJVM+M4w00U4oXsLMuPyRuOAOwAc9ozsmHmtSwnGtHoW+abhWV0qIRl55zPFNb3UVyz9nSAiAIgOGrooVfCLs8pBOp/rrO7D75uQ2MCENnTz9bbp6hJusW70EL/xO/N89PVPlFnZEERsPGFBzLbx7bl0d8r/Ou8maqMDhwjbdnTDfXhnNwXyYbLYDur5OUfUSi6l88/50pQi3NsbrWe0wsf7pRY+4AI/sAiUcjV0y961KdurY4+tDR3V8seBXulrtJwzWFjbcPH2+jEf4cX7/d5xPF4s4vkJS3vBd+IeeOiYXqlJzC2MuLKpTC8J6Ph3ifFX2jO4qhm31R1j1kNj6t+0W0pYsVT4ZndboiKQUyXsxXV+Yq6O4QBRYAxrZXFyyqL6tuTzUwdyPoGVHIRlawrLoyP6h+Z6TczRG6pn07JjhFpbSyzv8oy+9Hr62s6+O99shpB2MiJOdkabW5cKwuKQFZK9B2eMzY8Z2rZojGscZXV8XChX7aPTrBzSlaKB9uYXhcS2TFe1fs3Bh8rWoLnTIgouNfZch+au4MZoFvZOl/S8v2Jwdvpn6qL/7mbWflMmEdgCyL9d0x+TeQ8DM1RGVEf5B9V21se1RQYENFobLiC+n9TfqLRK+wPBnhPebn8/S63zb04jUCzlQc0+GQo+95RCchYZOif+ru5mun2SRVi/AFsT2V/ezLqJ7bOo/+rCqrzTFP1H8N5p3oF1wXLfznfcqFROWQKgxfkSLIvqVS8Trh5DuenFSF61fpHwYfxiYXvE1UYHStrCslKH6tIw2+cI4m/Iy+W/B66n7HiFtPqIQQ397dxJNvpOEuWGnHfWrslqbWqr2jyzO44TZFNmVC9Vs1t9z044OpI99AsND6NudNWWazq/UcWj7SDu809VhBZwwuLrOEV1PUnMnNZooJG+M8PWx+2Hgka4UVzeqZ7lt24vw8a4LCCeqdVx8ljZDW908qCqmRYxWytqoTKZqzb6itdPaFnLFtrJX8MVXRAW83o9q7gXjLrV82Hfc8OE5Kvr1fQ7GrfYjd8Zu1W/9t+ZbVaMwmLLOjSymYfrc/p7Rpirwx7wYmvB7CP9qAw0+U4+MHa5pDDkMPOMny3XF2ttk+pfxMMb8Bnuhf7lp9wOLt6XDAnH799a6fYNFG9qdoET/C0XIduD7wps7yiWV9pqGnqb45tSzyCoT5hUYMnDZ0oOU4UZpFtULaJto8eEioYX6mU3J/buy21KrMp8nQZc1fm9dybesmbL6B6JETx9LHx8S4BNZhWnwI7rC5bVrw2MfdI7ohOEKxDVNUfVrJvzn/fW1w7ej0uQ7F3tDGwd3fj3MQdRhoiA6sT5x/cuJyUkpPPzPCsmn4YVJtftBTILagMn5isjMwvlgLFZQHV8xPuVVk5KKAeHh8dOD8aGRrSsGGx6JjAuZGIUAYYdm2asp4Jr7Aa+vef9qAj0N1oEXkR5W7lCOWerwb3NcOu8EkgJOYQ3xFipIk3Q3VUpvftHqGZz5D0owdoUL/icoURYaqrn2QT5HUzmFYaMFBHT/e51SG2/PGHwJv7GIdLAYEhMRZGpBBSmPtksHPFcrjpWU9jW9P40y8MbBScdWiWUaeZojgKzoKorWNG8jMzTTA3XcaqWhPxmpYknMryfxWkjVfsKrrr9O6uDYR1j65VN3Q2ll53c7Kl0r2YgBEf5c2kOzpaezSlNpdKCrY31CAbqmTsKmWQzXpCbeUyNsiW+duOpjNJpjO3HecfjtCI02MTxNk7jqVO45V+5jYJ0cmX/ENaYrt8sFci9YnKip18ft1JGelV+Wla7setXa+eIZ9ozQgwAxRNJSpDSzB6DhHfYShBeUzxrG2QD3j438VTmk257fHyroxEBkN7QTGkkd2wDFk1UWuub2BxIy3D1EVXxcQETwe5Rbgmjr6WvuMc71jhdXUhwdW129XXg4Margtw4oxMcCpGZgEEMz8iQekcuZt4RAz6HWR1ZOXwW2ga4Xbgpj9QGZQlDY4qkkXtXJW7Li5Ett9IL6lNijEhRATaF4e7OgkKh9nGUOUylc51S/3j03oppbA9OjCGqVR6Jt9/KLEkryM1fEHWUFFFy0iOHgfoxULNQFMYd5ApPoUPTbSO9ixV8/uJwfOxGVKpGT4E+ZsY4D21yeK03ub8vf6I68/2OeCxzmffNHai5NEpWc52JkSa/XEqe1upeFHI0JVm9maGzTkDaVOEdJ6iQOXDE3fPVEfFovQ5vNxrRydVxyaaiTV3Jm9Uj9xr6EZ40IOtLWmBwM3anR5sZUkP8sEhryWnaTdUF6sTJEnyNyotaI6QNQYaO1pfeXQwf7emosKNLnnKHaLKKcVi3B7FVT163sgCcJXPfLTZnKx0kvXvoT2/x/fDQ4HMAAvIUU1UIx51dbVqkweGB2LqxxKGV58VFvbd2n9qdNVWkvrMi6tfQi9SWb3q1tZyUVVRteP/FlTEXcSpk23rsM02JhvbFdzNO5qa9NOYM93boZ4sG1L8nbTNvmkyPkmzU5Ex+pWoFVg9fTJjEeUn/YZ3jBWcy+sPwSYFxYVCiXuzeLbrwIeQKw+Z88JfPiI+y2CAx0J/GXgVdTVqKjEmFHJsxVg8//F+c2x7piMooMvipJalg0VZWknv1tSGzQ2ZGNw7d2ycFZmoq2Bkb6NfGlPmFjxgZUK1NapBrNG4tPLut3gt/COrSNfoocXl249662786PgMWjXMrSkWti4mKmihUsTdpdWI4Muhs9DaEfvujevcEVlxURbJMvby5neJauu6Kow1pQh5j5FGFxBC1la3NlBSbqQFhfMGJUq62Hu/5ALqHYI7dvwPG0g37UwVfF9WXLCVmPQ6Y+cb90JGoJlieSRjNM4irNwtglB8ivbq/cXelPYg87COp4a2xWHhJVcZMXkevnED1TQubr93RsqaiG1Eg4wRjUwk0G2NDR1tTc0cyPvLdc6l9jXztpM0zqvzWZktMfnvmPy+q/VxQnGdz+pCIVoj+YwFHKV9PiCicbQ8/ITNXyHP+EfV+qFQKC7DzwV4cU/Gb1lQqpWVG3vXz7w6yYFmf9j9SsV5j+H8mIs+LRg8RipKD0Q3o+K6UUUV3LBW7a4ypHApK74ZFfmlzkn3QJfZQHKTcvHlPQzlo5Y13ASdOFbznTLbU3Vx/+9kVe5kl6SVrUPr36DD6jwBRnKCLyUNbSNveZuo8UQvZi+7JLNkRfgcHM1RxagPCgir7bsW0RDgH9aAZzVauIcJBISKu9PdC9Uid3m3rxVcK9hEnka1anBEXbC/Gu1MT46kUq5EuLpfjgq3la/2qpZX6PboPqfq/TUspcL1VK2v2nMJOUihhSs0ucpV2jJG49lxObSCgeC2bLolJR2W3bJV5uK3huGVO9oWZMLy27araJ7LmPuKvEOLy7DiwQ+gCVA9/kEtGeW5MWmw6sfdZ4Cb89O/RBpPKYYVbjyL85Cr1xMZ5m+/lMt+QUnxkNd53+SEAP/U+EBRC56PebdF01CiabeRyP6qP8adfcfHfGR70ImadzoXSm0TYYUoKiqu8reTljuKl0zlUBbn+NlW0ZbQVtGB/Kklwu6fLC332VnGSUIcbVFhlWBVrJv6OcSVGOLmniRdHRl6ObRUOumw92pPXk9GUHmIrqyd66GrkD7TVvPL4sfLcG9R79NR+4ka6ZQT0zSpuay0oCYLSnwgVHxe44qKK12TpqfgZH6fNt8+b9qPQCDAuWrvUAfns8+MMvTg+/M36eP4sx/cJQOROvP98o/WHvmky+Jl01SM0RQu06kW0ixXyPb8Fu2gOzvza+W2MsD7JutSD1texGqZkxVB2tPr7+VjvQRk8bITQ3JswOj+/GqBI9U+wENTuMyY6qNOSfVgOahDpuCdZaq9uMra5uLSmiaoqKuqoa2wqKHj2gPOsgBPOHPaTlVP2RuWSUQ+yh67MzW+xtQWas0/NTQepteHhZCF+rVHpvYJuPIf9dbCzH3j1MyUS/FtFdlX+1MhrwW4sbdfGLZTW/nc/XC5hpOtRUkUfkcjvcDo1Ly4yM7rGdc66mEl2ktf9nerblkpnoqPvKCvreTp11tnWvfYLKS1+Qq2Rjc8RC1JMymoPrawoDk26GoynqHB8LsRw10ddeuOTYCvzZkcxYs5QoEkBwrJwoFS8FzBAGsdn52cEtvbnFLQ2AwqNB8/f7wn2BDgLIXTI1/XZbOI8pfHG6sFRqJQuSmf+03uT0FoAouMdV36b6ssfObQhx6LJAC5JOjRJ98RGpcOD2DRAQhya5724k8jD1h4LdidXlqFLf0sZHAuMoKD7AbsKt/0fd4/Vp3avNOQvtoYn3DQzIES+xSyatElnBRBl1EIxJbWQWNi6qCzRibfNxMqaOHTB3rsnzAXrlFKTk+Ij6npLznbZWQ9NHDQmMgeOSuV88kaWBdCjj8xcdAY+BGzkwpH7WRlK8dIdm1sakRKxZIVFUseqFiypmLJtqXBUOs/VYN0qxqkxdbQZDKinSjANtY0GVCNI2rW+QYwu3FzxP1tJrTwsMA9gQs8xgrXQUAg+piEBvc8AO9TRYB7B82uA0zKTvY9aVsiO7KMAXVr96Fvy3o5pLZl2cal7G+TUyFVKplYB8jK7gGyckCArJxkO4aSctWRmAcc7Z23QFeOs50JRMxy9qL1vQEsIWcX8+oHYP5WWo+9VD6nMDiLc6JPLoYrq2ZpweFL4V8lNE5YC4TiNRrdxrq3SZ45Yod7VSuQtwW8h29WD9RD9b36Qf2ofOoENGaJvLi9evlnscbfzfoKezWBi4ALpm9MFZ3GrBj76YeKhcuttl0XEj+tLt+hSGi9rYo30M/p7eyA/mZncQGG+fvzOIB+1KhaU7Eq93cnn/2sRH/GKclAHTBq1HryTc8B8eoWlUbzLlRPPfgx3OU/MvJRPjN91RHLfjqMCqMqVOxQbpH1YQlrhhabAAPqR2x0NtgHGNRn9ocodjiDWYl8D5aI5mxIDwAF+9rUCsQj/UhMU5U3VJcb+BZcVfymPs0fqIX6TAapZ8NwAACtg67xOwwCAw0T4LOrgnRo2wn4dkTc4jenXTU1PcGo7iuLM0qssQ2rItpq23y6rpi+xag4S7c9CdQAwHbtWVoNAGyRVTneWQiZm339JuEK2sXY7CVskr7XR2A11BempA0zJ7tp82vRP4R3iHAcG24evvJawFAFpj8UU9a6hj0EOBHtUkfMSiAthb3s8eg+1CU3iDaglTAmFQQrrIoZTf79qy+L347/dZpcBXHcIOVjkUUiWOl0X/euKL6KbNpI0NO8oGlkqcM0DXzkF0SqhkFba9VgtBv81xAHBlwEotPBK/km/UUdTbREmhlfUCARF12oGgDiZi0aBVNXh8M5J+lxPrDFdgLelkQndU26kql14QNWIDYDHMz22q3XfuV8zGCrG1e7ju7z9OZmW/xU6KRYf2n7vLg6PY6rggg/TnDCYN5ArVLRMszoi8RbvRidqBT4QRwDzbwejOvaA+FBu/snkevL36NLw0A2JSp/ZYtzXlZepEJbPG2DYoG6MMfnzY8lvR3kVohZoZs02MbZTTy0J2kUXe4iQpFA6/Q16/CHEAeSA0luC4oNhVkZSSJiWi2VzxorYN57xglrecSfIibcqwd2fIP0eMnHCOQRy92EjVPodQgCwvzBW3ZbRMeVBCtgkb0M7Iei0Yi2FSZm8KbHyNqxyMi82eCSNUMSaGykSeYom5c7tIEMVY/sbfxiB67p0EWdWBq5/i+hGD/pr3gY4jd9PpjHP/uPmyv8H6GoG/T5oZw3Ps1IjQoU80yVZ37C1NV3UJfbAZSlXdCInmskDUIG5iCLED5MEYmf/rgHy3VbNS+AmggWloUyyTmOItrE5/stmvFhYNPM6lxeTRjdPPU9Ve/Xr1ONggA/sCPoQE0wap7mMKPbAAFViIk/Bn+Ji7S3S4VXu36PTnlCUSsEYtarvpLFb1/F+Mndb+5ixD/v/rXnpCdkFWl3H8FejWJ/fuaXCuOUgV9e1n5WlZeMGASEKZXMUj8qy6RfDN7yRZKeQR+xi+8yibpBMcWr8JYneBRZo9cbECHehUqo80BiYNtw3omjF/M5s0eldajzCASsr5hcK0s3l1DTt299pdvGArEkDIs7EA/vccNVIi6c0wZOn7qomzJHjh584UG0vhu30+Xg8sRYOCbbb+I24mZnZiS1ZEXSkqT+AgWqJ4Fupjk1CV6/3y5bI00QTtfgd9cx/rn/1z6KHOnf1Y8z1V4I6rOuTndX4yf737w6yZ12vbkplXB1hSDFElpngPZrfI41eEFXYQGlc5tFNnefRLYSPXaGYW486eSiQXf60ppav6xjvNXfMgx+SdRyf0ogZjQZW2kNG3/CqxIhfqKYUISB9yxO6vkkRJXZrmTN20AiQlVPRv/1KcY/p39NMfh4iszrpslz/FTZ7DFh6iGzpfyEZNnAQPkVwDZkF6UiL/RjQtnzZZZskEDOAQDbucuWakJBarN0DFEswgS6puuQkjT7t9PbGAgPyEMnp9c40oOYitlqBHTIm7ri2diq8gUZsxUBABwGP48Zkes1fCDQmuYoZGI3hx5TNxPNd+AqXfY4BgvTgxEgoCmGMK96kGiQz0kNRYImgcl9sCG6KnlfHTG25icamjVDYqhmQEaktXTBd/FKA2WlO6tPEM63D0Mw1sYVMj6CU9MByMFCJZmy9ONZ/2FO4krErkh8EohWk2YGh4BmWzYrUqq5qK0yHE3cSQEirOm9EQa0HspGbztwhVogYVNX2agNVayCCXzI6dToMLnUBJJPJBMiB97JhYJ0ttozI59rfmCuRwz2CJLZFE7SyE70Nkh4gGObrr86QH6MKUqJLEps54zAyQriWuTRI1YCLe3zRcA4brrrp3CIodramAkf74v6besCbEANNKb1BV27bPiL3GkE1T7fLwXNlSEFltuYuICXFqGKyvtponxPoLfPKBh18MKFNDNWrJqsTOZpatqKYba35CuQpmRQL6+IWOfOIWdUfMDQ2oxA55NTAwcvkr1mxIlVk5EibFF3xrQGhxBy3sIUqhX0uNoYp+bMKOGg9gQfb7/MzYg6J+dtswyVSgmpYp7i906F1i0ZvNcLwfyXkURqI02FTvdEeeJS+7OtE9rjY8zqKCNpJmjyDYQ1u5I0D+JNE6j1qkKNvxG51x6NFHpW+LgPIRjoLhgKMOPA9CiwwtN0xAFuQoAaRDhvboQPWZIM1aQeEGkUgDyEH1nrNEAi6Bj4bxDNJRVmvRVv2f/cZ0E0hXQraGuymPpjlrnAwZ3cC5NwATly11GKZe6nsKZC/AAhapzlE5jQnhIAsMvBnvAOZ1jgbH3DyGmZbWXhK3pzilyyDMGdATrMCdTzjJQl0Mu51xbWbSYyIMSMCDasp6L6cDpqIO4lbN3EwTk3syQfRW0853SRLZNESl7vAV1E6qMZqjvdLHCjxPgadwWtRU+i7STHzMPlyrSdutoi4o0gVYln+YqYZbtso3X/nvPoPCWbTw/REtGjhHvTgoBp08sOJfi6RyoJYr/1VkfRvTgq5oZfzo+hWNALurvuKI6hWFDrqk36LKDqSo9rKQWrwCVWWdlDsLupSMl76ImTidyOTgydSOJNQ6qcWdnkMSMLvvVO6ahaZ7qmzAy3sNAk++WwKtDALiapLxRE1pwZ4qZplJmpFxwHfpYerT6CrTdBsVrbu1UU+UJjMCW+Vg6LIzGhEONsgsYJ6+ZbqhWhHsSrWeZZDtkNtu7rIi9ZWAryVCD4TMyq4f08VRjWjQJLI69T+Hqf/bpiXjtgrt/5ecxCvnwuvOg+6oG/6c5WNFIc+XuIxHsz3pacO+WYs0sxKyUilMdIQ2IUgswYswx22sOMt7cwbqKb1T1DACGa9BFHgvTIyB8B52fGatpzOq8pqw9jfnC4MC8/ZnPYQYsPs7tcNzku1D04GaeqJ3mU+FrPrhO5TkaPegxct64bPIoftcHbj/aknz+IDs+JBtS1qgO1uwOUL+lUaWMPJFh743rtHC0Gtku6bk+K8186VZ+x7QzYA0aDKiiTsgmlrJ12zwF08UHrccnFlLaP1EFW6IcqvdlT25naG+TtWYVILHQeF0dn4yOXBYV8RV4hlnarpoxa18g0MhMT+/05Rpgb8wQ8HOdbX3wYbTj7ptPhNCB6buuq6r48e3tdySigrBf+eoeA1ewHVR1yo5H1xTe7FySZKcbxP1hpzVatlSCavkx5CbAEvmSVZlYqp4mj1HnFxLpXwF0oHN33tvFkA2kzRY16Cqqr4JHQX2L1EJavoR/ycw/nyzd7a+82nuSFs93xHnp7mMj+PRKsZMrYfbcWy0zD0iSobukzVvWMZdVHwVw9mzATpBBJ/v/Sp4XW+7ALt/ALTiEwxIdsf9G/4z/yX4Rn4SD8bP7n6WP9e+2/o/ukeadasse2NvyCter3eqM6vFnz8Dasg2z68BEQiIDiKeVbXp5DlBEbB8ZJNzqZE4Yua4uXrDacLiIw/OUD4A6gArxs2h3b3DAzyK0uKXsc3H9nNZba2Hp3dqsUI/og9P5jiqbO1eypeVkTIa4xXBOtuuZtmzo7vGOOzUt1ejzcdONq/uPiqHrl+magzlezpDOrUqLcCMISrsCG7dIqJOR+bphhe3sdC++i66vZsUEqSC6AmF08/5f5ZAbivEoRDPXKlHmATCVmdKdEAz5TFlU+ySa4t+ZtaWIKthcULB/Y9dIhVqUZyGlFySmUuGa+owzQ/iK2wql3Bo98+BY3my21qVqfSVmmpB+rW+WDYInaJBXupw56Kq7vhOOwpDo/HkbpGhxFOqZI+6pPvoEBfhg8KQSaGcKLHso0uUeykZ32I5rLXU/vaJ3If4Jmeb9+jw1SU57lmvWc5fiZOuryOMe1i6IcHw6PH39MHh71ZGCt8RseItzZ8qTq2XqdwE83TSN5CIFpzWnTuadN5M5QnaZfyc02m8sWbnBDN/+DON0cXiecj18jbhMdZy76FFJixiWzAfnDUDjVY+t6RkSNxzlmF7b27NywoHDWdYp6IZElPB5OT1ZQIyyct+VZKhuf/OCZBPsuJ4+SqKEhHLdz9C7+ZTwejk+UafXTGIbpuZxmywdEGP6SwdUWX2zCE1kbbz6Y4+gNRFLRZAuihTsuCDay76qmUco0TTXhKQ8NmkY1pOFyOOgO0HpCq4QCueuCehkjF3dSTSURf+6fYFowx2z2S2Bypx6myhBqtDCdZv/yZJWs26RQK04+io8EB6uyx5k3BkbRrQenybJOCp+rP3EMaQK4WnQi6vgw3aVD5O7gr0GoOEjY8y71cHN2vNW8eRZd+ib3ZuQiQOLf5TE6Puc1wCi6e9VQLA6E1gEooi1xCjnIXPA9q/5IAtfdvIkwSOLTcH/fjf5ErBJx6cRcOBV0IAQFPf4sz//ni5iS3gDkKxDSG2VSO4VJaoJ88ShojWqQ1ISNC0k91Sq0SaXsuJfSTVnzSf7RH0QSySk5itgFzE3oyZsEmnBqEN7r7OWi9H439cuapEW6E6T0rir+eBcNeFyShzLqZAa7DrYPn68sXZ7iX2wH8GqOYP5GqsyOchrIF01DO1HX6gWjppdtlTkFEpGbIGgrQ1cEyq5E9blJ0pxJZAIypSlOMqzRkgs4baNO9MEW24t8zROmZJAO5skjHtXoO6Pf+SngTyOdfN5XlRiWpQOEGNiRbEDXvPGJIIF6BoEIWT6TcNydrGhrH9JRF0s5ir0sFVqp5I7C/WB/iM9pc9kv38Su7Wvrai93zkxQ+w8TxDCOxzVcFF/kHLvx7h1nhzwT0Tyl0RGiOdmu48X4RHmJVpg9owKHspWzpTcsh1ve2TLi0japT5BXq7b7WJ2uhEJH6GpWoLpQVnVeYb2ybmyI0QhAdfQ2jAHNRFiZjyKbUYIw1H2qANWBLSUz6YyOcNQmit+OwHg88xoYDz2j89HVvbv+13jfGCE+7t7HGNSGuMVBQ2zuuvje2orTcZg19nLKLZvYmngZh9wFqhf4a6fVKH+B8aahgc2FNfOLHQ/jYVtjmjOYpRFgxiY918BC9v99fCF5rcJQ8crJDwqEEUR7g7ONBxiYR+Tz9L47wEpiyMeNxKn08VgmbxBN1MKTX9ESiYsHb2qPCD55lvP/6UbRLJPVBCozSOUUXK5ij52lyxqXW8yM32vCwzLVy1cmDHhDiOom7AsB/tmr+AeGsTR4SPaJjvvlM35lrzL4GXt6QVtmEqfz9n7toW0smhE7V1msHIEbQvvKrlVorKjdluo3BBEBAXK1Rd/6+zs+9lfrd06ZOQDgjZ8EDwD4KGw/LlX/53xjTgQIJxiAAMazZl8AzNliqpoqxg2QJ0znLy2HFxpiNi2SG0jIQno1ZZ7ucvS+y7XrIYQZ3VyUkCvOtFoS5UIjvkquiQtJssT8Xb6kmq7ALdgE62E17I+9sDZ2fbrt08DlPE6jhKhWiYySFdt+6sJ4lln3wNGXk9y12Hes5EoyyONu9AguvUVyUpRWrDNdWEOU6AhDdW82mVaeXQq70E9lHTCuLzrTjUR2TRzDZLV+jEh9Fqw+Q0oNsc0NyG3wtYvItyJQPkClTBnVVaElz6CSGRQZMV+SqkLGdYlfyghO4amuTISmjMThvdCK519MBiEorT4P0FuKeg7gppctHnz9O5Il5FghwIdg02ykmOy6MrJdUYDsz/QOkqqSZ03w7FlsyhR3lqTOgd7uchlM2Ldcme2vvctfYg3csgXT2iQkljnH/Cm15u4pZgvvei+7HTBLfzl5god299Jbq+j218F9lPcgym6I4WKlseRr0snxCrDzoJ+DsAI4023NqHrq6ezqNtOhWi1ySo9+T+GsV4aO3l9L67zSJV+jSg4TDBScg1XUmFSaWqswq6cbnVVVyQ6rR+8CupXK4DysCoB/rbAl8Dzj4xi3UQ051uHbD8Vnu5j2RFQJA3EvAH1BFYOE4HjFj3KP45cMmi5GM0ZsGgzytfR+IO2+Aveh1yATBWUA61ZIOn8KV+UcO5/IClcMMGcL9ABAfU24dkiNwdOx+b/UcDomYEWMw8bYxMb6pjfMnyLAvchMYBEYggB/McDGAAIEYEEgga/BQYCFzTwObLpRjiP7opqSEHBTGh4aG9d2SodiZA6IOFTjn+PR7F9zAcfIoadAeO1PgeH0fQqciD97RExhcyqEp7ATCfyF+NmFdZZfKI/PP5zZnK5ZETn/oVrZeZ3/j8Drn7lO0E9ax/uCa4Q+sECvcr5UaXSOYjX2KLlQNnco3ZwlMlE21KLMoWLIMb/wt8gauYcPpwgTFJPyIJ0hwCkrKlUTOAuUadSmzrhCyPLm6IDtyDlA+pan8hvPEzlPkT94lEQ4wOMz2pRBhGvJe4jnQ0hSPc53VTR0otm0EVaRg6o1l2baChWJ03ki5kw5EqzKozx6rg3JVCTKe+Mr2FqZmNm7mMlVmiriCRhzhNMAXrb1FxAZLQo8Y/ubjBMXbjx48eEnAEmQEBRhx4gQJeY4cRIkSZEmAw1DlpwTTjqVxzj3PHkXKLiYbkQ5p7Gp5qRGy9Zq5erRZ8CQ0b2HiSTmOjbN3IIWLFmxznn8r4QdCnsOqBzROKFz5sKVG/dg0yBVmhFldjHlyXZDm8Zgl+WpFMXBEXPkKpfhnpfBpVq7b776rl6X+2Z18+CpgJcHvM2Zt+ihfyzY42PVkmU9fH1SaN2aR/wceC9TAH+BggUJUStUGIZwEaJEihZjX6xL4sS7LMFNda5IlOSqQx/ctoGlN7g99sKT4In5YwF9+g0ZNmXAoGnpOoI/FjJqzN1AhqAcT/krBnIKSipqGja0dPQMjEzMbNmxsOeEU84456Lz+fIJFovF4otup8wo71rT5aBRMWTHxmWoFdIaVh5PoDz+ALXVMH4pv269ZCHnHr9Rffq0i7CTms/mc8U4Nv06TORLwSXeNB5HirpIbPQBbnjAB21vQUzzWeVSb5SoK/Ges11vyI/c5/wOKInOASXTOXm4j4n8KADPG3pGd5I/IUE2KE3HjwFrDgBA73LwAQeAA7qPcENlrgRXDqS1nftE97fSXo3E1Sd++831vFWLEHcm+u23HzfLTOwLfz4uhpmSk3TQLGf4Wy8uZ+SZxO3hyqDeIp/sqZnUhz9uLocz6H+/VfuZ934Oo+2doHTXEtyzTPJD36Lnhym+hT7VuvGm4ig+DuWbKA5TvFf5pHKn/ED5P5p0srKhDVDvmifGJ6GtYS3+CjT5io9r5U75jfJ/8SZKdWzFJ1EVZ3b0Zy8BAA==') format('woff2');
      unicode-range: U+0000-00FF, U+0131, U+0152-0153, U+02BB-02BC, U+02C6, U+02DA, U+02DC, U+2000-206F, U+2074, U+20AC, U+2122, U+2191, U+2193, U+2212, U+2215, U+FEFF, U+FFFD;
    }



      /* GENERAL */
      [href]:focus, [tabindex]:focus, input:not([disabled]):focus, select:not([disabled]):focus, button:not([disabled]):focus {
        outline: 2px dotted #aeb0b5;
        outline-offset: 3px;
      }

      body,html {
          height: 100%;
          height: auto; /* IE 11 Fix */
          min-height: 100%;
          overflow-x: hidden;
      }
      body {
        margin: 0;
        display: -webkit-box;
        display: -ms-flexbox;
        display: flex;
        -webkit-box-orient: vertical;
        -webkit-box-direction: normal;
        -ms-flex-direction: column;
        flex-direction: column;
        margin: 0;
        background-color: #fff;
        font-family: "Roboto", "Helvetica Neue", Arial, Tahoma;
        color: rgba(27,27,27,1);
        font-size: 1.09rem;
      }
      main {
        -webkit-box-flex: 1 0 auto;
        -ms-flex: 1 0 auto;
        flex: 1 0 auto;
        padding: 20px 10px;
      }
      @media (min-width: 480px) {
        main {
          padding: 20px 40px;
        }
      }

      @media (min-width: 992px) {
        main {
          padding: 40px 83px;
        }
      }

      .bg-primary {
          color: #ffffff;
      }
      .text-white {
        color: #ffffff !important;
      }
      .container {
        width: 100%;
        padding-right: 15px;
        padding-left: 15px;
        margin-right: auto;
        margin-left: auto;
      }

      @media (min-width: 992px) {
        .container {
          max-width: 980px;
        }
      }

      .container-fluid {
        width: 100%;
        margin-right: auto;
        margin-left: auto;
      }

      .row {
        display: -webkit-box;
        display: -ms-flexbox;
        display: flex;
        -ms-flex-wrap: wrap;
        flex-wrap: wrap;
        margin-right: -15px;
        margin-left: -15px;
      }

      .col-12,.col,
      .col-lg-3,
      .col-lg-12,
      .col-lg,
      .col-xl-auto {
        position: relative;
        width: 100%;
        min-height: 1px;
        padding-right: 15px;
        padding-left: 15px;
      }
      .col-12 {
        -webkit-box-flex: 0;
        -ms-flex: 0 0 100%;
        flex: 0 0 100%;
        max-width: 100%;
      }

      .list-inline {
        padding-left: 0;
        list-style: none;
      }

      ol,
      ul,
      dl {
        margin-top: 0;
        margin-bottom: 1rem;
      }

    /* SKIPNAV */
    .usa-skipnav{
        font-family: "Roboto", "Helvetica Neue", Arial, Tahoma;
        font-size:1.06rem;
        line-height:1.5;
        background:transparent;
        left:0;
        padding:0.5rem 1rem;
        position:absolute;
        top:-3.8rem;
        -webkit-transition:all 0.2s ease-in-out;
        transition:all 0.2s ease-in-out;
        z-index:100;
    }
    .usa-skipnav:focus{
        background:white;
        left:0;
        position:absolute;
        top:0;
        -webkit-transition:all 0.2s ease-in-out;
        transition:all 0.2s ease-in-out;
    }

      /* HEADER */
html {
  box-sizing: border-box; }

*, *::after, *::before {
  box-sizing: inherit; }

.ncbi-header {
  background-color: #20558a;
  z-index: 10;
  padding: 14px 0 10px 0; }
  .ncbi-header a {
    color: inherit;
    text-decoration: none; }
  .ncbi-header a:hover {
    color: #ffffff;
    text-decoration: underline; }
  .ncbi-header .ncbi-header__logo {
    width: auto;
    float: left; }
  .ncbi-header .header-button {
    width: auto;
    margin: 1.5rem 0.3rem;
    background-color: transparent;
    color: #ffffff;
    border: 1px solid rgba(255, 255, 255, 0.5);
    font-size: 1.4rem;
    font-weight: normal;
    white-space: nowrap;
    padding: 0.8rem; }
    .ncbi-header .header-button:hover {
      background-color: #0071bc;
      text-decoration: none; }
    .ncbi-header .header-button .fa {
      margin: 0; }
    @media screen and (min-width: 600px) {
      .ncbi-header .header-button {
        font-size: 1.7rem; }
        .ncbi-header .header-button .fa {
          margin: 0 0.2rem; } }
    @media screen and (min-width: 1201px) {
      .ncbi-header .header-button {
        padding: 1rem 2rem; }
        .ncbi-header .header-button .fa {
          margin-left: 0;
          margin-right: 0.5rem; } }
  .ncbi-header .desktop-only {
    display: none; }
    @media screen and (min-width: 600px) {
      .ncbi-header .desktop-only {
        display: inherit; } }
  .ncbi-header .account-old {
    float: left;
    display: block;
    font-size: 1.4rem;
    position: relative;
    width: 30%;
    text-align: right; }
    @media screen and (min-width: 600px) {
      .ncbi-header .account-old {
        width: 30%;
        font-size: 1.7rem; } }
  .ncbi-header .logo {
    width: 245px;
    margin-top: 13px;
    margin-right: 10px;
    display: inline-block;
    margin-bottom: 5px; }
    @media (min-width: 375px) {
      .ncbi-header .logo {
        width: 280px;
        height: 42px; } }
    @media (min-width: 640px) {
      .ncbi-header .logo {
        width: 414px;
        height: 63px;
        margin-bottom: 0; } }



      /* MAIN */
      /* Title */
      h1, h2 {
        font-family: "Roboto", "Helvetica Neue", Arial, Tahoma;
      }
      h1 {
        color: #205493;
        font-size: 6rem;
        line-height: 0rem;
        margin-top:2.5rem;
      }
      h2 {
        font-size: 1.6rem;
        margin-top: 15px;
      }

      @media (min-width: 480px){
        h1 {
          font-size: 8rem;
          line-height: 0.5rem;
          margin-top:3rem;
        }
        h2 {
          font-size: 2rem;
          margin-top: 40px;
        }
      }

      /* Content */

      @media (min-width: 640px) and (max-width: 991px) {
        .flex-child, .flex-child ul li {
          text-align: center;
          margin-right: auto;
          margin-left: auto;
        }
        .flex-child:not(:last-child), .flex-child ul li:not(:last-child)  {
          margin-bottom: 20px !important;
        }

      }

      @media (min-width: 992px) {
        .usa-search {
          margin-right: -5px;
        }
      }

      .usa-button{
        display: block;
        margin: 1em auto;
      }

      .usa-search {
        -webkit-box-pack: center;
        -ms-flex-pack: center;
        justify-content: center;
      }

      .usa-input  {
        height:2.45em;
        width: 100%;
        border: 1px solid #666666;
      }
      .usa-button__search {
        height: 2.32em!important;
      }

      @media (min-width: 480px) {
        .usa-input {
          width: 60%;
          max-width: 300px;
        }
      }
      @media (min-width: 640px) {
        .usa-button {
          display: inline-block;
          margin: 0 1em 0 0;
        }
      }
      @media (min-width: 992px) {
        .usa-input {
          width: calc(100% - 92px);
          max-width: none;
        }
      }
      .usa-button span{
        display: none;
      }
      @media all and (min-width: 480px){
        .usa-button span{
          display: inline-block;
        }
      }


      /* FOOTER */
footer {
  margin-top: auto;
  letter-spacing: 0.5px; }
  footer ol, footer ul, footer dl {
    margin-top: 0;
    margin-bottom: 1rem; }
  footer .social_media a {
    width: 35px;
    height: 35px;
    display: inline-block;
    margin-right: 5px; }
  footer .pt-5, footer .py-5 {
    padding-top: 1rem; }
    @media (min-width: 992px) {
      footer .pt-5, footer .py-5 {
        padding-top: 3rem; } }
  footer .bottom-links {
    margin: 0 auto; }
  footer .bottom-links ul {
    list-style: none;
    padding-left: 0px;
    display: -webkit-inline-box;
    display: -ms-inline-flexbox;
    display: inline-flex;
    -webkit-box-orient: horizontal;
    -webkit-box-direction: normal;
    -ms-flex-direction: row;
    flex-direction: row;
    -ms-flex-wrap: nowrap;
    flex-wrap: nowrap;
    -webkit-box-pack: center;
    -ms-flex-pack: center;
    justify-content: center; }
  footer .bottom-links ul li {
    padding: 0px 8px;
    position: relative;
    font-size: 18px; }
  footer .bottom-links ul li:first-child {
    padding-left: 0px; }
  footer .bottom-links ul li:not(:last-child) {
    border-right: 1px solid #FFFFFF; }

@media (min-width: 992px) {
  .col-lg-3 {
    -webkit-box-flex: 0;
    -ms-flex: 0 0 25%;
    flex: 0 0 25%;
    max-width: 25%; }
  .col-lg-12 {
    -webkit-box-flex: 0;
    -ms-flex: 0 0 100%;
    flex: 0 0 100%;
    max-width: 100%; }
  .centered-lg {
    display: -webkit-box;
    display: -ms-flexbox;
    display: flex;
    -webkit-box-pack: center;
    -ms-flex-pack: center;
    justify-content: center; } }

.icon_social {
  width: 35px;
  height: 35px;
  display: inline-block;
  margin-right: 5px;
  margin-bottom: 1rem; }

.icon-section {
  background-color: #dbdbdb; }

.icon-section_header {
  background-color: #90a6c7;
  text-align: center;
  color: #fff;
  text-transform: uppercase;
  font-size: 18px;
  font-weight: bold;
  padding: 16px;
  margin-top: 50px; }

.icon-section_header::after {
  display: none;
  content: "";
  border: solid #fff;
  border-width: 0px 3px 3px 0px;
  padding: 7px;
  -ms-transform: rotate(45deg);
  transform: rotate(45deg);
  -webkit-transform: rotate(45deg);
  margin-left: 15px;
  position: absolute;
  margin-top: -2px; }

.icon-section_header.opened::after {
  -ms-transform: rotate(-135deg);
  transform: rotate(-135deg);
  -webkit-transform: rotate(-135deg);
  margin-top: 6px; }

.icon-section_container {
  display: -webkit-box;
  display: -ms-flexbox;
  display: flex;
  -webkit-box-pack: justify;
  -ms-flex-pack: justify;
  justify-content: space-between; }

.icon-section_header.opened + .grid-container .icon-section_container {
  display: -webkit-box;
  display: -ms-flexbox;
  display: flex; }

.footer-icon {
  display: block;
  width: 40px;
  height: 40px;
  margin: 20px 0; }

/* Added after adding USWDS */
.bg-primary {
  background-color: #20558A; }

.icon-section_header {
  background-color: #4773aa; }


      footer p {
        line-height: 1.5em;
        margin-top: 0;
        margin-bottom: 10px;
      }
      @media (min-width: 992px) {
        footer .pt-5,
        footer .py-5 {
          padding-top: 30px;
        }
      }
      footer .mt-3,
      footer .my-3 {
        margin-top: 10px;
      }
      footer .mt-3 li {
        margin-bottom: 0.3em;
      }

      /* ADDITIONAL NWDS OVERRIDES */
      .usa-grid{
          margin-left:auto;
          margin-right:auto;
          padding-right:15px;
          padding-left:15px;
        }

        .usa-grid::after{
          clear:both;
          content:"";
          display:block;
        }

        @media screen and (min-width: 600px) {
          .usa-grid{
            padding-right:30px;
            padding-left:30px;
          }
        }


        @media screen and (min-width: 992px) {
          .usa-grid {
            max-width:980px;
          }

        }

      .list-inline {
        padding-left: 0;
        list-style: none;
      }
      .list-inline-item {
        display: inline-block;
      }
      a {
        text-decoration: none;
      }
      </style>
</head>
<body >
    <a class="usa-skipnav" href="#main_content">Skip to main content</a>
    <section class="usa-banner">
      <div class="usa-accordion">
        <header class="usa-banner-header">
          <div class="usa-grid usa-banner-inner">
            <img src="https://www.ncbi.nlm.nih.gov/coreutils/uswds/img/favicons/favicon-57.png" alt="U.S. flag" />
            <p>An official website of the United States government</p>
            <button
                    class="usa-accordion-button usa-banner-button"
                    aria-expanded="false"
                    aria-controls="gov-banner-top"
            >
              <span class="usa-banner-button-text">Here's how you know</span>
            </button>
          </div>
        </header>
        <div
                class="usa-banner-content usa-grid usa-accordion-content"
                id="gov-banner-top"
        >
          <div class="usa-banner-guidance-gov usa-width-one-half">
            <img
                    class="usa-banner-icon usa-media_block-img"
                    src="https://www.ncbi.nlm.nih.gov/coreutils/uswds/img/icon-dot-gov.svg"
                    alt="Dot gov"
            />
            <div class="usa-media_block-body">
              <p>
                <strong>The .gov means it’s official.</strong>
                <br />
                Federal government websites often end in .gov or .mil. Before
                sharing sensitive information, make sure you’re on a federal
                government site.
              </p>
            </div>
          </div>
          <div class="usa-banner-guidance-ssl usa-width-one-half">
            <img
                    class="usa-banner-icon usa-media_block-img"
                    src="https://www.ncbi.nlm.nih.gov/coreutils/uswds/img/icon-https.svg"
                    alt="Https"
            />
            <div class="usa-media_block-body">
              <p>
                <strong>The site is secure.</strong>
                <br />
                The <strong>https://</strong> ensures that you are connecting to the
                official website and that any information you provide is encrypted
                and transmitted securely.
              </p>
            </div>
          </div>
        </div>
      </div>
    </section>
    <div class="usa-overlay"></div>
    <header class="ncbi-header bg-primary">
      <div class="usa-grid">
          <div class="usa-width-one-whole">
          <div class="ncbi-header__logo">
            <a href="https://www.ncbi.nlm.nih.gov/" class="logo" aria-label="NCBI Logo">
              <svg xmlns="http://www.w3.org/2000/svg" viewBox="0 0 2039.55 243.26">
                <defs>
                  <style>
                    .cls-1 {
                      fill: #fff!important;
                    }
                  </style>
                </defs>
                <g id="Layer_2" data-name="Layer 2">
                  <g id="Text_outlines" data-name="Text outlines">
                    <path class="cls-1"
                      d="M266.77,67.24V176H248.18v-49.2H199.53V176H180.4V67.24H199v43.19h48.66V67.24ZM161.26,176H142.68V67.24h18.58Zm-37.17,0H104.41L55.76,96.21h-.55V176h-18V67.24H56.85l49.2,79.81h.55V67.24h18V176Zm208.83-54.66L266.77,0H21.87A22.05,22.05,0,0,0,0,22.41V220.85a22.05,22.05,0,0,0,21.87,22.41H266.22Z" />
                    <path class="cls-1"
                      d="M283.17,242.72l66.69-121.36L283.17,0h16.4c9.29,0,20.23,6.56,24.6,14.76l58.49,106.6L324.17,228c-4.37,8.2-15.31,14.76-24.6,14.76Z" />
                    <path class="cls-1"
                      d="M428.15,31.14h16.5L485.4,96.89h.25V31.14h14.88v89.25H484L443.4,54.76H443v65.63H428.15Z" />
                    <path class="cls-1"
                      d="M571.15,106a7.54,7.54,0,0,0,.69,3.75,2.9,2.9,0,0,0,2.69,1.13H576a9.16,9.16,0,0,0,2-.25v9.87c-.5.17-1.15.36-1.94.57s-1.61.39-2.44.56-1.67.29-2.5.37a20,20,0,0,1-2.12.13,13.78,13.78,0,0,1-7.25-1.75q-2.88-1.76-3.75-6.13a25.29,25.29,0,0,1-10.44,6,41.17,41.17,0,0,1-11.94,1.88,29.25,29.25,0,0,1-8.37-1.19,22,22,0,0,1-7.07-3.5,16.81,16.81,0,0,1-4.87-5.87,18.11,18.11,0,0,1-1.81-8.32,19.18,19.18,0,0,1,2.18-9.75,16.27,16.27,0,0,1,5.75-5.87,25.79,25.79,0,0,1,8-3.06,90.4,90.4,0,0,1,8.94-1.44,70.49,70.49,0,0,1,7.38-1.06A34.66,34.66,0,0,0,552,81a9.49,9.49,0,0,0,4.25-2.31A6.37,6.37,0,0,0,557.78,74a7.28,7.28,0,0,0-1.32-4.5,8.78,8.78,0,0,0-3.25-2.68,13.68,13.68,0,0,0-4.31-1.25,34.25,34.25,0,0,0-4.5-.32,17.93,17.93,0,0,0-9.87,2.5,9.74,9.74,0,0,0-4.38,7.75H515.9a21.45,21.45,0,0,1,3-10.37,20.76,20.76,0,0,1,6.69-6.63,27.57,27.57,0,0,1,9.19-3.5,55.13,55.13,0,0,1,10.5-1,44.65,44.65,0,0,1,9.37,1A26.74,26.74,0,0,1,563,58.26a18,18,0,0,1,5.94,5.82,15.93,15.93,0,0,1,2.25,8.68ZM556.9,88a17.36,17.36,0,0,1-8,2.57c-3.17.29-6.33.73-9.5,1.31A30,30,0,0,0,535,93a12.93,12.93,0,0,0-3.75,1.88A8.22,8.22,0,0,0,528.71,98a10.78,10.78,0,0,0-.93,4.69,6,6,0,0,0,1.37,4,10,10,0,0,0,3.31,2.56,15.17,15.17,0,0,0,4.25,1.31,26.44,26.44,0,0,0,4.19.38,23.14,23.14,0,0,0,5.13-.63,16.81,16.81,0,0,0,5.18-2.12,13.72,13.72,0,0,0,4.07-3.81,9.69,9.69,0,0,0,1.62-5.69Z" />
                    <path class="cls-1"
                      d="M580,55.76h10.75V36.39H605V55.76H617.9V66.39H605v34.5a35.69,35.69,0,0,0,.18,3.87,6.71,6.71,0,0,0,.88,2.75,4.15,4.15,0,0,0,2.06,1.69,10.07,10.07,0,0,0,3.75.56q1.5,0,3-.06a14.79,14.79,0,0,0,3-.44v11l-4.62.5a41.2,41.2,0,0,1-4.63.25,31.47,31.47,0,0,1-9.06-1.06,12.17,12.17,0,0,1-5.38-3.12,10.85,10.85,0,0,1-2.62-5.19,38.6,38.6,0,0,1-.81-7.13V66.39H580Z" />
                    <path class="cls-1" d="M628.52,31.14h14.25v13.5H628.52Zm0,24.62h14.25v64.63H628.52Z" />
                    <path class="cls-1"
                      d="M687.9,122.14a35.31,35.31,0,0,1-13.81-2.56,29.4,29.4,0,0,1-10.25-7.07,30.09,30.09,0,0,1-6.38-10.75,43.85,43.85,0,0,1,0-27.37,30.09,30.09,0,0,1,6.38-10.75,29.25,29.25,0,0,1,10.25-7.06,38.39,38.39,0,0,1,27.62,0A29.34,29.34,0,0,1,712,63.64a30.24,30.24,0,0,1,6.38,10.75,44,44,0,0,1,0,27.37A30.24,30.24,0,0,1,712,112.51a29.5,29.5,0,0,1-10.25,7.07A35.31,35.31,0,0,1,687.9,122.14Zm0-11.25a16.37,16.37,0,0,0,8.25-2,17.35,17.35,0,0,0,5.75-5.25,23,23,0,0,0,3.31-7.31,32.91,32.91,0,0,0,0-16.57,22.18,22.18,0,0,0-3.31-7.31,17.83,17.83,0,0,0-5.75-5.19,18,18,0,0,0-16.5,0,17.83,17.83,0,0,0-5.75,5.19,22,22,0,0,0-3.31,7.31,32.61,32.61,0,0,0,0,16.57,22.83,22.83,0,0,0,3.31,7.31,17.35,17.35,0,0,0,5.75,5.25A16.37,16.37,0,0,0,687.9,110.89Z" />
                    <path class="cls-1"
                      d="M732.4,55.76h13.5v9.5l.25.25a23.83,23.83,0,0,1,8.5-8.43A22.56,22.56,0,0,1,766.27,54q10.62,0,16.75,5.5T789.15,76v44.38H774.9V79.76q-.25-7.62-3.25-11.06t-9.38-3.44a15.41,15.41,0,0,0-6.5,1.32,14,14,0,0,0-4.87,3.62,17,17,0,0,0-3.13,5.44,19.38,19.38,0,0,0-1.12,6.62v38.13H732.4Z" />
                    <path class="cls-1"
                      d="M858.27,106a7.54,7.54,0,0,0,.69,3.75,2.9,2.9,0,0,0,2.69,1.13h1.5a9.16,9.16,0,0,0,2-.25v9.87c-.5.17-1.15.36-1.94.57s-1.61.39-2.44.56-1.67.29-2.5.37a20,20,0,0,1-2.12.13,13.78,13.78,0,0,1-7.25-1.75q-2.88-1.76-3.75-6.13a25.29,25.29,0,0,1-10.44,6,41.17,41.17,0,0,1-11.94,1.88A29.25,29.25,0,0,1,814.4,121a22.07,22.07,0,0,1-7.07-3.5,16.81,16.81,0,0,1-4.87-5.87,18.11,18.11,0,0,1-1.81-8.32,19.29,19.29,0,0,1,2.18-9.75,16.27,16.27,0,0,1,5.75-5.87,25.89,25.89,0,0,1,8-3.06,90.4,90.4,0,0,1,8.94-1.44,70.49,70.49,0,0,1,7.38-1.06A34.66,34.66,0,0,0,839.08,81a9.43,9.43,0,0,0,4.25-2.31A6.33,6.33,0,0,0,844.9,74a7.28,7.28,0,0,0-1.32-4.5,8.7,8.7,0,0,0-3.25-2.68A13.68,13.68,0,0,0,836,65.58a34.25,34.25,0,0,0-4.5-.32,17.93,17.93,0,0,0-9.87,2.5,9.74,9.74,0,0,0-4.38,7.75H803a21.45,21.45,0,0,1,3-10.37,20.76,20.76,0,0,1,6.69-6.63A27.57,27.57,0,0,1,821.9,55a55.13,55.13,0,0,1,10.5-1,44.65,44.65,0,0,1,9.37,1,26.65,26.65,0,0,1,8.31,3.25A18,18,0,0,1,856,64.08a15.93,15.93,0,0,1,2.25,8.68ZM844,88a17.36,17.36,0,0,1-8,2.57c-3.17.29-6.33.73-9.5,1.31A30,30,0,0,0,822.15,93a12.93,12.93,0,0,0-3.75,1.88A8.22,8.22,0,0,0,815.83,98a10.78,10.78,0,0,0-.93,4.69,6,6,0,0,0,1.37,4,10,10,0,0,0,3.31,2.56,15.27,15.27,0,0,0,4.25,1.31,26.55,26.55,0,0,0,4.19.38,23.14,23.14,0,0,0,5.13-.63,16.81,16.81,0,0,0,5.18-2.12,13.72,13.72,0,0,0,4.07-3.81A9.69,9.69,0,0,0,844,98.64Z" />
                    <path class="cls-1" d="M874,31.14h14.25v89.25H874Z" />
                    <path class="cls-1" d="M940.52,31.14h15.63v75.75h45.37v13.5h-61Z" />
                    <path class="cls-1" d="M1010.65,31.14h14.25v13.5h-14.25Zm0,24.62h14.25v64.63h-14.25Z" />
                    <path class="cls-1"
                      d="M1040.77,31.14H1055v33h.25a19.61,19.61,0,0,1,3.63-4.25,22.61,22.61,0,0,1,4.68-3.19,24.84,24.84,0,0,1,5.38-2,23.25,23.25,0,0,1,5.56-.69,30.88,30.88,0,0,1,13.31,2.69,26.21,26.21,0,0,1,9.44,7.38A32,32,0,0,1,1102.9,75a46.38,46.38,0,0,1,1.87,13.38,47.08,47.08,0,0,1-1.69,12.62,32.79,32.79,0,0,1-5.12,10.82,25,25,0,0,1-21.06,10.31,50.47,50.47,0,0,1-6.57-.44A24.4,24.4,0,0,1,1064,120a21.45,21.45,0,0,1-5.44-3.25,15.76,15.76,0,0,1-4.06-5.25h-.25v8.88h-13.5Zm49.75,57a32.14,32.14,0,0,0-1.12-8.5,23,23,0,0,0-3.38-7.31,17.35,17.35,0,0,0-5.62-5.13,15.32,15.32,0,0,0-7.75-1.94q-9,0-13.57,6.25t-4.56,16.63a33.14,33.14,0,0,0,1.19,9.06,20.45,20.45,0,0,0,3.56,7.19,17.79,17.79,0,0,0,5.69,4.75,16.19,16.19,0,0,0,7.69,1.75,16,16,0,0,0,8.25-2,17.37,17.37,0,0,0,5.56-5.19,20.85,20.85,0,0,0,3.12-7.25A36.57,36.57,0,0,0,1090.52,88.14Z" />
                    <path class="cls-1"
                      d="M1116.77,55.76h13.37v12.5h.25a14.47,14.47,0,0,1,2.44-5.12,23.55,23.55,0,0,1,4.38-4.56,22.05,22.05,0,0,1,5.68-3.32,17.13,17.13,0,0,1,6.38-1.25,31.47,31.47,0,0,1,3.44.13l1.93.25V68.14c-1-.17-2-.31-3.06-.44a26.73,26.73,0,0,0-3.06-.19,16.32,16.32,0,0,0-6.81,1.44,15.76,15.76,0,0,0-5.57,4.25,21,21,0,0,0-3.75,6.94,30.24,30.24,0,0,0-1.37,9.5v30.75h-14.25Z" />
                    <path class="cls-1"
                      d="M1214.89,106a7.54,7.54,0,0,0,.69,3.75,2.9,2.9,0,0,0,2.69,1.13h1.5a9.16,9.16,0,0,0,2-.25v9.87c-.5.17-1.15.36-1.94.57s-1.6.39-2.44.56-1.66.29-2.5.37a20,20,0,0,1-2.12.13,13.78,13.78,0,0,1-7.25-1.75q-2.88-1.76-3.75-6.13a25.22,25.22,0,0,1-10.44,6,41.07,41.07,0,0,1-11.94,1.88A29.3,29.3,0,0,1,1171,121a21.91,21.91,0,0,1-7.06-3.5,16.73,16.73,0,0,1-4.88-5.87,18.11,18.11,0,0,1-1.81-8.32,19.18,19.18,0,0,1,2.19-9.75,16.11,16.11,0,0,1,5.75-5.87,25.69,25.69,0,0,1,8-3.06,89.73,89.73,0,0,1,8.93-1.44,70.87,70.87,0,0,1,7.38-1.06,34.94,34.94,0,0,0,6.19-1.07A9.54,9.54,0,0,0,1200,78.7a6.37,6.37,0,0,0,1.56-4.69,7.34,7.34,0,0,0-1.31-4.5,8.86,8.86,0,0,0-3.25-2.68,13.74,13.74,0,0,0-4.32-1.25,34.25,34.25,0,0,0-4.5-.32,17.93,17.93,0,0,0-9.87,2.5,9.76,9.76,0,0,0-4.38,7.75h-14.25a21.45,21.45,0,0,1,3-10.37,20.76,20.76,0,0,1,6.69-6.63,27.57,27.57,0,0,1,9.19-3.5,55.13,55.13,0,0,1,10.5-1,44.65,44.65,0,0,1,9.37,1,26.71,26.71,0,0,1,8.32,3.25,18,18,0,0,1,5.93,5.82,15.93,15.93,0,0,1,2.25,8.68Zm-14.25-18a17.32,17.32,0,0,1-8,2.57q-4.74.44-9.5,1.31a30,30,0,0,0-4.37,1.06,12.93,12.93,0,0,0-3.75,1.88,8.1,8.1,0,0,0-2.56,3.12,10.63,10.63,0,0,0-.94,4.69,6,6,0,0,0,1.37,4,9.94,9.94,0,0,0,3.32,2.56,15.07,15.07,0,0,0,4.25,1.31,26.33,26.33,0,0,0,4.18.38,23.07,23.07,0,0,0,5.13-.63,17,17,0,0,0,5.19-2.12,13.8,13.8,0,0,0,4.06-3.81,9.69,9.69,0,0,0,1.62-5.69Z" />
                    <path class="cls-1"
                      d="M1230.27,55.76h13.37v12.5h.25a14.47,14.47,0,0,1,2.44-5.12,23.55,23.55,0,0,1,4.38-4.56,22.05,22.05,0,0,1,5.68-3.32,17.13,17.13,0,0,1,6.38-1.25,31.6,31.6,0,0,1,3.44.13l1.93.25V68.14c-1-.17-2-.31-3.06-.44a26.73,26.73,0,0,0-3.06-.19,16.32,16.32,0,0,0-6.81,1.44,15.76,15.76,0,0,0-5.57,4.25,21,21,0,0,0-3.75,6.94,30.24,30.24,0,0,0-1.37,9.5v30.75h-14.25Z" />
                    <path class="cls-1"
                      d="M1267.14,55.76h15.63L1299.64,104h.25l16.38-48.25h14.87L1306,123.89c-1.17,2.91-2.31,5.71-3.44,8.37a30.11,30.11,0,0,1-4.12,7.07,17.89,17.89,0,0,1-6.07,4.87,20.62,20.62,0,0,1-9.25,1.81,64.81,64.81,0,0,1-9.87-.75v-12c1.16.17,2.29.36,3.37.57a18.63,18.63,0,0,0,3.38.31,11.51,11.51,0,0,0,4.12-.63,6.74,6.74,0,0,0,2.69-1.81,11.22,11.22,0,0,0,1.81-2.81,28.64,28.64,0,0,0,1.38-3.75l1.62-5Z" />
                    <path class="cls-1"
                      d="M1403.52,122.14a35.31,35.31,0,0,1-13.81-2.56,29.4,29.4,0,0,1-10.25-7.07,30.09,30.09,0,0,1-6.38-10.75,43.85,43.85,0,0,1,0-27.37,30.09,30.09,0,0,1,6.38-10.75,29.25,29.25,0,0,1,10.25-7.06,38.39,38.39,0,0,1,27.62,0,29.34,29.34,0,0,1,10.25,7.06A30.24,30.24,0,0,1,1434,74.39a44,44,0,0,1,0,27.37,30.24,30.24,0,0,1-6.38,10.75,29.5,29.5,0,0,1-10.25,7.07A35.35,35.35,0,0,1,1403.52,122.14Zm0-11.25a16.42,16.42,0,0,0,8.25-2,17.35,17.35,0,0,0,5.75-5.25,23,23,0,0,0,3.31-7.31,32.91,32.91,0,0,0,0-16.57,22.18,22.18,0,0,0-3.31-7.31,17.83,17.83,0,0,0-5.75-5.19,18,18,0,0,0-16.5,0,17.73,17.73,0,0,0-5.75,5.19,22,22,0,0,0-3.31,7.31,32.61,32.61,0,0,0,0,16.57,22.83,22.83,0,0,0,3.31,7.31,17.25,17.25,0,0,0,5.75,5.25A16.37,16.37,0,0,0,1403.52,110.89Z" />
                    <path class="cls-1"
                      d="M1441.64,55.76h10.63V50.39a27.59,27.59,0,0,1,1.5-9.94,14,14,0,0,1,4-5.87,13,13,0,0,1,5.68-2.75,31.62,31.62,0,0,1,6.69-.69,41,41,0,0,1,10,.87V43.14a19.9,19.9,0,0,0-2.94-.56,30.26,30.26,0,0,0-3.68-.19,8.73,8.73,0,0,0-4.94,1.37c-1.38.92-2.06,2.71-2.06,5.38v6.62h12.12V66.39h-12.12v54h-14.25v-54h-10.63Z" />
                    <path class="cls-1"
                      d="M1523.89,31.14h22L1570.51,101h.25l24-69.87h21.75v89.25h-14.87V51.51h-.25l-24.75,68.88h-12.88L1539,51.51h-.25v68.88h-14.87Z" />
                    <path class="cls-1"
                      d="M1644.39,91.76a24.75,24.75,0,0,0,1.06,7.25,17.8,17.8,0,0,0,3.19,6.13,15.45,15.45,0,0,0,5.37,4.19,17.77,17.77,0,0,0,7.75,1.56q6.26,0,10.07-2.69a15.89,15.89,0,0,0,5.68-8.06H1691a26.76,26.76,0,0,1-10.5,16.31,28.53,28.53,0,0,1-8.68,4.25,35,35,0,0,1-10.07,1.44,34.36,34.36,0,0,1-13.5-2.5,27.91,27.91,0,0,1-9.93-7,29.73,29.73,0,0,1-6.13-10.75,43.83,43.83,0,0,1-2.06-13.75,38.84,38.84,0,0,1,2.19-13.06,33.28,33.28,0,0,1,6.25-10.88A29.3,29.3,0,0,1,1661.39,54a29.07,29.07,0,0,1,13.69,3.19,30.14,30.14,0,0,1,10.06,8.44A34.3,34.3,0,0,1,1691,77.7a37,37,0,0,1,.94,14.06Zm33.25-9.37a23.13,23.13,0,0,0-1.44-6.5,17.23,17.23,0,0,0-3.25-5.44,16.07,16.07,0,0,0-5-3.75,14.72,14.72,0,0,0-6.56-1.44,17,17,0,0,0-6.81,1.32,15.36,15.36,0,0,0-5.25,3.62,17.84,17.84,0,0,0-3.5,5.44,18.76,18.76,0,0,0-1.44,6.75Z" />
                    <path class="cls-1"
                      d="M1763.64,120.39h-13.5v-8.75h-.25a16.91,16.91,0,0,1-8.38,8.06,28.26,28.26,0,0,1-11.62,2.44,30.85,30.85,0,0,1-13.31-2.69,26.5,26.5,0,0,1-9.44-7.31,31.27,31.27,0,0,1-5.63-10.94,47.43,47.43,0,0,1-1.87-13.56A43.46,43.46,0,0,1,1702,72.51a30.33,30.33,0,0,1,6.32-10.5,24.3,24.3,0,0,1,9-6.06A28.64,28.64,0,0,1,1727.64,54a34,34,0,0,1,6.12.57,26.68,26.68,0,0,1,6,1.81,23.33,23.33,0,0,1,5.32,3.19,17.84,17.84,0,0,1,4.06,4.56h.25v-33h14.25Zm-49.75-31.63a31.5,31.5,0,0,0,1.06,8.13,22.18,22.18,0,0,0,3.25,7.12,15.81,15.81,0,0,0,13.56,6.88,16,16,0,0,0,8.19-2,17,17,0,0,0,5.63-5.25,24.09,24.09,0,0,0,3.25-7.31,33.12,33.12,0,0,0,1.06-8.32q0-10.74-4.81-16.75a15.87,15.87,0,0,0-13.07-6,16.06,16.06,0,0,0-8.43,2.07A17.21,17.21,0,0,0,1718,72.7a22.21,22.21,0,0,0-3.12,7.5A38.78,38.78,0,0,0,1713.89,88.76Z" />
                    <path class="cls-1" d="M1779.51,31.14h14.25v13.5h-14.25Zm0,24.62h14.25v64.63h-14.25Z" />
                    <path class="cls-1"
                      d="M1852.89,77.39q-.89-6-4.82-9.06a15.62,15.62,0,0,0-9.93-3.07,20.65,20.65,0,0,0-5.88.94,14,14,0,0,0-5.75,3.5,19.49,19.49,0,0,0-4.37,7.13,33.82,33.82,0,0,0-1.75,11.93,35.16,35.16,0,0,0,.93,8,22.05,22.05,0,0,0,3,7.13,16.3,16.3,0,0,0,5.32,5.06,15.1,15.1,0,0,0,7.87,1.94,14.29,14.29,0,0,0,10.31-3.88q4.07-3.87,5.07-10.87h14.25q-2,12.63-9.57,19.31t-20.06,6.69a33.22,33.22,0,0,1-13.44-2.56,28.68,28.68,0,0,1-9.81-7A29.59,29.59,0,0,1,1808.2,102a41.12,41.12,0,0,1-2.06-13.25,45,45,0,0,1,2-13.62,31.05,31.05,0,0,1,6-11.06,28,28,0,0,1,9.93-7.38A33.59,33.59,0,0,1,1838,54a38.93,38.93,0,0,1,10.69,1.44,28.42,28.42,0,0,1,9,4.31,23.17,23.17,0,0,1,6.44,7.25,25.06,25.06,0,0,1,3,10.38Z" />
                    <path class="cls-1" d="M1879.14,31.14h14.25v13.5h-14.25Zm0,24.62h14.25v64.63h-14.25Z" />
                    <path class="cls-1"
                      d="M1908.89,55.76h13.5v9.5l.25.25a23.83,23.83,0,0,1,8.5-8.43A22.56,22.56,0,0,1,1942.76,54q10.62,0,16.75,5.5t6.13,16.5v44.38h-14.25V79.76q-.26-7.62-3.25-11.06t-9.38-3.44a15.41,15.41,0,0,0-6.5,1.32,14,14,0,0,0-4.87,3.62,17,17,0,0,0-3.13,5.44,19.38,19.38,0,0,0-1.12,6.62v38.13h-14.25Z" />
                    <path class="cls-1"
                      d="M1991.76,91.76a24.75,24.75,0,0,0,1.06,7.25,17.8,17.8,0,0,0,3.19,6.13,15.48,15.48,0,0,0,5.38,4.19,17.74,17.74,0,0,0,7.75,1.56q6.24,0,10.06-2.69a15.9,15.9,0,0,0,5.69-8.06h13.5a26.88,26.88,0,0,1-10.5,16.31,28.59,28.59,0,0,1-8.69,4.25,34.91,34.91,0,0,1-10.06,1.44,34.29,34.29,0,0,1-13.5-2.5,27.94,27.94,0,0,1-9.94-7,29.73,29.73,0,0,1-6.13-10.75,43.83,43.83,0,0,1-2.06-13.75,38.84,38.84,0,0,1,2.19-13.06A33.46,33.46,0,0,1,1986,64.2,29.3,29.3,0,0,1,2008.76,54a29,29,0,0,1,13.69,3.19,30.14,30.14,0,0,1,10.06,8.44,34.13,34.13,0,0,1,5.81,12.06,37,37,0,0,1,.94,14.06ZM2025,82.39a23.13,23.13,0,0,0-1.44-6.5,17.23,17.23,0,0,0-3.25-5.44,16.07,16.07,0,0,0-5-3.75,14.69,14.69,0,0,0-6.56-1.44,17,17,0,0,0-6.81,1.32,15.55,15.55,0,0,0-5.25,3.62,17.84,17.84,0,0,0-3.5,5.44,18.76,18.76,0,0,0-1.44,6.75Z" />
                    <path class="cls-1"
                      d="M438.78,164.56l19.12,44.33h.15L467,164.56h6.9l-11.33,53.55H454.9l-19-44h-.15l-9.08,44h-6.9l11.33-53.55Z" />
                    <path class="cls-1"
                      d="M479.39,185.45a14.1,14.1,0,0,1,3.79-3.94,15.83,15.83,0,0,1,5.1-2.32,23.15,23.15,0,0,1,5.92-.75,31.06,31.06,0,0,1,5.4.45,13.69,13.69,0,0,1,4.5,1.57,8.55,8.55,0,0,1,3.11,3,9.13,9.13,0,0,1,1.17,4.84,16.68,16.68,0,0,1-.42,3.56c-.27,1.27-.53,2.44-.78,3.49L504.7,206c-.15.8-.36,1.7-.64,2.7a11,11,0,0,0-.41,2.85,2.64,2.64,0,0,0,.53,1.88,1.82,1.82,0,0,0,1.35.52,3.12,3.12,0,0,0,1-.19l1-.33-1,4.72a12.34,12.34,0,0,1-1.92.56,8.91,8.91,0,0,1-2,.27,5.23,5.23,0,0,1-4-1.43,4.69,4.69,0,0,1-1.05-4l-.15-.15a13.35,13.35,0,0,1-5,4.12,18.69,18.69,0,0,1-8,1.43,17.94,17.94,0,0,1-4.62-.57,9.5,9.5,0,0,1-3.71-1.87,9.3,9.3,0,0,1-2.51-3.38,12.1,12.1,0,0,1-.94-5.06,10.71,10.71,0,0,1,1.84-6.67,11.57,11.57,0,0,1,4.69-3.64,23.14,23.14,0,0,1,6.3-1.69q3.45-.45,6.67-.75c1.7-.15,3.16-.31,4.39-.49a9.91,9.91,0,0,0,3-.86,3.81,3.81,0,0,0,1.76-1.72,7.06,7.06,0,0,0,.56-3.08,4.07,4.07,0,0,0-.75-2.55,5.39,5.39,0,0,0-1.87-1.54,8.85,8.85,0,0,0-2.52-.78,16.59,16.59,0,0,0-2.66-.23,17,17,0,0,0-3.56.38,10.28,10.28,0,0,0-3.19,1.23,8.35,8.35,0,0,0-2.4,2.18,7.13,7.13,0,0,0-1.27,3.19H477.4A13.45,13.45,0,0,1,479.39,185.45Zm1.8,26.59a8.86,8.86,0,0,0,4.84,1.35q7.58,0,10.87-5.1a12.73,12.73,0,0,0,2.14-4.73c.37-1.7.79-3.45,1.24-5.25h-.15a8.74,8.74,0,0,1-3.42,1.39c-1.37.27-2.83.49-4.38.64s-3.12.33-4.69.56A18.11,18.11,0,0,0,483.4,202a7.84,7.84,0,0,0-3.07,2.13,6,6,0,0,0-1.28,3.87A4.47,4.47,0,0,0,481.19,212Z" />
                    <path class="cls-1"
                      d="M536.65,179.34l-1.2,5.62h-7.72l-4.8,22.8c0,.45-.1.88-.15,1.28a10.18,10.18,0,0,0-.08,1.27,2.08,2.08,0,0,0,1.16,2.06,6,6,0,0,0,2.67.57,9.48,9.48,0,0,0,1.87-.19,17.19,17.19,0,0,0,1.8-.49l-1.12,5.85c-.75.1-1.5.19-2.25.26a21.2,21.2,0,0,1-2.25.12,20,20,0,0,1-3.38-.27,7.61,7.61,0,0,1-2.74-1,5.52,5.52,0,0,1-1.87-1.91,5.93,5.93,0,0,1-.71-3.08,9.92,9.92,0,0,1,.11-1.57c.07-.5.16-1.05.26-1.65l5.1-24.08h-6.52l1.2-5.62h6.52l2.4-11.48h6.38l-2.4,11.48Z" />
                    <path class="cls-1" d="M550.08,179.34,542,218.11h-6.3l8-38.77Zm-5-7,1.65-7.8h6.45l-1.65,7.8Z" />
                    <path class="cls-1"
                      d="M555.36,193.66a23.64,23.64,0,0,1,4.28-7.8,21.21,21.21,0,0,1,6.82-5.4,20,20,0,0,1,9.11-2q7.88,0,12,4.08t4.13,12a29.67,29.67,0,0,1-1.43,9.15,23.82,23.82,0,0,1-4.2,7.83,20.66,20.66,0,0,1-6.75,5.44,19.69,19.69,0,0,1-9.07,2,18.72,18.72,0,0,1-6.86-1.2A14.26,14.26,0,0,1,555,209.3a18.17,18.17,0,0,1-1.12-6.49A29.11,29.11,0,0,1,555.36,193.66Zm7.62,16.8q2.68,2.92,7.94,2.93a10.78,10.78,0,0,0,6.19-1.8,16.48,16.48,0,0,0,4.5-4.54,21.36,21.36,0,0,0,2.78-6,22,22,0,0,0,.93-6.08,15.3,15.3,0,0,0-.59-4.27,9.33,9.33,0,0,0-1.88-3.49,9.12,9.12,0,0,0-3.19-2.33,11,11,0,0,0-4.54-.86,11.59,11.59,0,0,0-6.45,1.8A16.35,16.35,0,0,0,564,190.4a20.61,20.61,0,0,0-2.81,6,23.25,23.25,0,0,0-.94,6.3A10.89,10.89,0,0,0,563,210.46Z" />
                    <path class="cls-1"
                      d="M609.62,179.34l-1.2,5.85h.15a15.14,15.14,0,0,1,6.08-5.07,18.35,18.35,0,0,1,7.72-1.68c3.65,0,6.37.8,8.14,2.4s2.66,4.12,2.66,7.57a23.49,23.49,0,0,1-.3,3.3c-.2,1.35-.47,2.78-.82,4.28l-4.73,22.12H621l4.95-22.65c.05-.4.12-.86.22-1.39s.2-1.07.3-1.65.19-1.12.27-1.65a10.28,10.28,0,0,0,.11-1.31,4.59,4.59,0,0,0-1.95-4.09,8.44,8.44,0,0,0-4.8-1.31,11.67,11.67,0,0,0-5.21,1.28,14.73,14.73,0,0,0-4.39,3.22,10.53,10.53,0,0,0-2.7,3.64,26.79,26.79,0,0,0-1.58,4.46l-4.5,21.45h-6.3l8.1-38.77Z" />
                    <path class="cls-1"
                      d="M643.34,185.45a14.06,14.06,0,0,1,3.78-3.94,15.83,15.83,0,0,1,5.1-2.32,23.22,23.22,0,0,1,5.93-.75,31.06,31.06,0,0,1,5.4.45,13.69,13.69,0,0,1,4.5,1.57,8.55,8.55,0,0,1,3.11,3,9.13,9.13,0,0,1,1.16,4.84,16.64,16.64,0,0,1-.41,3.56c-.27,1.27-.54,2.44-.79,3.49L668.65,206c-.15.8-.36,1.7-.64,2.7a11,11,0,0,0-.41,2.85,2.64,2.64,0,0,0,.52,1.88,1.82,1.82,0,0,0,1.35.52,3.18,3.18,0,0,0,1-.19l1-.33-1,4.72a12.18,12.18,0,0,1-1.91.56,9,9,0,0,1-2,.27,5.21,5.21,0,0,1-4-1.43,4.69,4.69,0,0,1-1-4l-.15-.15a13.38,13.38,0,0,1-5,4.12,18.69,18.69,0,0,1-7.95,1.43,17.86,17.86,0,0,1-4.61-.57,9.5,9.5,0,0,1-3.71-1.87,9.3,9.3,0,0,1-2.51-3.38,12.1,12.1,0,0,1-.94-5.06,10.71,10.71,0,0,1,1.84-6.67,11.53,11.53,0,0,1,4.68-3.64,23.14,23.14,0,0,1,6.3-1.69q3.45-.45,6.68-.75c1.7-.15,3.16-.31,4.39-.49a9.84,9.84,0,0,0,3-.86,3.84,3.84,0,0,0,1.77-1.72,7.06,7.06,0,0,0,.56-3.08,4.07,4.07,0,0,0-.75-2.55,5.43,5.43,0,0,0-1.88-1.54,8.78,8.78,0,0,0-2.51-.78,16.59,16.59,0,0,0-2.66-.23,17,17,0,0,0-3.56.38,10.28,10.28,0,0,0-3.19,1.23,8.35,8.35,0,0,0-2.4,2.18,7.14,7.14,0,0,0-1.28,3.19h-6.37A13.45,13.45,0,0,1,643.34,185.45Zm1.8,26.59a8.83,8.83,0,0,0,4.83,1.35q7.57,0,10.88-5.1a12.73,12.73,0,0,0,2.14-4.73q.56-2.55,1.23-5.25h-.15a8.69,8.69,0,0,1-3.41,1.39c-1.37.27-2.84.49-4.39.64s-3.11.33-4.68.56a18.11,18.11,0,0,0-4.24,1.09,7.88,7.88,0,0,0-3.08,2.13A6,6,0,0,0,643,208,4.47,4.47,0,0,0,645.14,212Z" />
                    <path class="cls-1" d="M693.55,164.56,682.3,218.11H676l11.17-53.55Z" />
                    <path class="cls-1"
                      d="M755.39,214.17q-5.89,5.15-15.79,5.14-11,0-17-6.11t-6-17.29a37.86,37.86,0,0,1,2-12.41,32.13,32.13,0,0,1,5.82-10.39,27.51,27.51,0,0,1,21.56-9.82,26.66,26.66,0,0,1,8.06,1.16,18.43,18.43,0,0,1,6.45,3.45,15.87,15.87,0,0,1,4.31,5.77,19.64,19.64,0,0,1,1.58,8.14h-7.13q0-6.3-3.71-9.41a14.34,14.34,0,0,0-9.56-3.11,19.47,19.47,0,0,0-9.79,2.36,22.07,22.07,0,0,0-6.94,6.11,26.89,26.89,0,0,0-4.16,8.51,34.16,34.16,0,0,0-1.39,9.64,24.58,24.58,0,0,0,1,7.13,15.14,15.14,0,0,0,2.92,5.51,13.23,13.23,0,0,0,4.92,3.56,17.62,17.62,0,0,0,7,1.28q6.6,0,10.72-3.49a19,19,0,0,0,5.85-9.86h7.13Q761.28,209,755.39,214.17Z" />
                    <path class="cls-1"
                      d="M775.07,204a9.33,9.33,0,0,0,.83,4,8.21,8.21,0,0,0,2.25,2.93,10.91,10.91,0,0,0,3.22,1.8,11.28,11.28,0,0,0,3.75.64,12.12,12.12,0,0,0,7-1.92A11.25,11.25,0,0,0,796.3,206h6.37a16.72,16.72,0,0,1-2.4,5.66,15.16,15.16,0,0,1-4,4,17.5,17.5,0,0,1-5.18,2.44,21.47,21.47,0,0,1-6,.83,19.1,19.1,0,0,1-8-1.47,13.82,13.82,0,0,1-5.06-3.75,13.45,13.45,0,0,1-2.62-5,20,20,0,0,1-.75-5.29,30.46,30.46,0,0,1,1.61-10.16,25.1,25.1,0,0,1,4.35-7.91,19.42,19.42,0,0,1,6.37-5.1,17,17,0,0,1,7.62-1.8q8.55,0,12.48,4.5t3.94,12.67a17.34,17.34,0,0,1-.22,2.85c-.15.9-.28,1.63-.38,2.18H775.3A24.88,24.88,0,0,0,775.07,204Zm23.36-13a9.17,9.17,0,0,0-1.5-3.53,7.9,7.9,0,0,0-2.88-2.47,9.45,9.45,0,0,0-4.43-.94,13.78,13.78,0,0,0-5,.86,12.5,12.5,0,0,0-3.86,2.37,14,14,0,0,0-2.77,3.48,20.71,20.71,0,0,0-1.8,4.24h22.5A14.2,14.2,0,0,0,798.43,191Z" />
                    <path class="cls-1"
                      d="M822.17,179.34l-1.2,5.85h.15a15.14,15.14,0,0,1,6.08-5.07,18.31,18.31,0,0,1,7.72-1.68q5.48,0,8.14,2.4t2.66,7.57a23.49,23.49,0,0,1-.3,3.3c-.2,1.35-.48,2.78-.82,4.28l-4.73,22.12H833.5l5-22.65c0-.4.12-.86.22-1.39s.2-1.07.3-1.65.19-1.12.26-1.65a8.91,8.91,0,0,0,.12-1.31,4.59,4.59,0,0,0-2-4.09,8.44,8.44,0,0,0-4.8-1.31,11.75,11.75,0,0,0-5.22,1.28,14.81,14.81,0,0,0-4.38,3.22,10.41,10.41,0,0,0-2.7,3.64,26.79,26.79,0,0,0-1.58,4.46l-4.5,21.45h-6.3l8.1-38.77Z" />
                    <path class="cls-1"
                      d="M874.22,179.34,873,185H865.3l-4.8,22.8c0,.45-.11.88-.15,1.28a10.18,10.18,0,0,0-.08,1.27,2.08,2.08,0,0,0,1.16,2.06,6,6,0,0,0,2.67.57,9.48,9.48,0,0,0,1.87-.19,17.19,17.19,0,0,0,1.8-.49l-1.12,5.85c-.75.1-1.5.19-2.25.26a21.2,21.2,0,0,1-2.25.12,20,20,0,0,1-3.38-.27,7.61,7.61,0,0,1-2.74-1,5.52,5.52,0,0,1-1.87-1.91,5.93,5.93,0,0,1-.71-3.08,9.92,9.92,0,0,1,.11-1.57c.07-.5.16-1.05.26-1.65l5.1-24.08H852.4l1.2-5.62h6.52l2.4-11.48h6.38l-2.4,11.48Z" />
                    <path class="cls-1"
                      d="M880.67,204a9.19,9.19,0,0,0,.83,4,8.21,8.21,0,0,0,2.25,2.93,10.79,10.79,0,0,0,3.22,1.8,11.28,11.28,0,0,0,3.75.64,12.12,12.12,0,0,0,7-1.92,11.17,11.17,0,0,0,4.12-5.51h6.38a16.72,16.72,0,0,1-2.4,5.66,15.2,15.2,0,0,1-4,4,17.33,17.33,0,0,1-5.17,2.44,21.47,21.47,0,0,1-6,.83,19.1,19.1,0,0,1-8-1.47,13.82,13.82,0,0,1-5.06-3.75,13.3,13.3,0,0,1-2.62-5,20,20,0,0,1-.75-5.29,30.46,30.46,0,0,1,1.61-10.16,25.1,25.1,0,0,1,4.35-7.91,19.42,19.42,0,0,1,6.37-5.1,17,17,0,0,1,7.62-1.8q8.55,0,12.48,4.5t3.94,12.67a17.34,17.34,0,0,1-.22,2.85c-.15.9-.28,1.63-.38,2.18H880.89A26.62,26.62,0,0,0,880.67,204ZM904,191a9.17,9.17,0,0,0-1.5-3.53,7.85,7.85,0,0,0-2.89-2.47,9.38,9.38,0,0,0-4.42-.94,13.78,13.78,0,0,0-5,.86,12.5,12.5,0,0,0-3.86,2.37,14,14,0,0,0-2.77,3.48,20.71,20.71,0,0,0-1.8,4.24h22.5A14.58,14.58,0,0,0,904,191Z" />
                    <path class="cls-1"
                      d="M927.54,179.34l-1.87,8.32h.15a21.18,21.18,0,0,1,5.74-6.6,13.49,13.49,0,0,1,8.36-2.62,7.87,7.87,0,0,0,1.12-.08,3,3,0,0,1,1.13.08l-1.5,6.82a4.6,4.6,0,0,0-1-.07h-.9c-.8,0-1.45,0-1.94,0a9.68,9.68,0,0,0-1.88.34,12.38,12.38,0,0,0-4.69,2.33,16.56,16.56,0,0,0-3.56,4,15.72,15.72,0,0,0-2,4.39c-.5,1.67-.9,3.24-1.2,4.69l-3.67,17.17h-6.3l8-38.77Z" />
                    <path class="cls-1"
                      d="M962,185l1.12-5.62h6.6c.5-2,1-3.85,1.39-5.7a18.7,18.7,0,0,1,1.84-4.92,9.43,9.43,0,0,1,3.34-3.45,11.43,11.43,0,0,1,6-1.31c.9,0,1.8,0,2.7.11a13.47,13.47,0,0,1,2.62.49l-1,5.4c-.55-.1-1.07-.19-1.57-.26a9,9,0,0,0-1.43-.11,6.35,6.35,0,0,0-3.6.86,5.82,5.82,0,0,0-2,2.25,11.28,11.28,0,0,0-1,3.11c-.23,1.15-.52,2.33-.87,3.53h7.43l-1,5.62h-7.5l-7.13,33.15h-6.37l7.2-33.15Z" />
                    <path class="cls-1"
                      d="M984.58,193.66a23.64,23.64,0,0,1,4.28-7.8,21.21,21.21,0,0,1,6.82-5.4,19.92,19.92,0,0,1,9.11-2q7.88,0,12,4.08t4.13,12a29.67,29.67,0,0,1-1.43,9.15,23.82,23.82,0,0,1-4.2,7.83,20.66,20.66,0,0,1-6.75,5.44,19.69,19.69,0,0,1-9.07,2,18.72,18.72,0,0,1-6.86-1.2,14.26,14.26,0,0,1-8.37-8.44,18.17,18.17,0,0,1-1.12-6.49A29.11,29.11,0,0,1,984.58,193.66Zm7.61,16.8q2.7,2.92,7.95,2.93a10.78,10.78,0,0,0,6.19-1.8,16.76,16.76,0,0,0,4.5-4.54,21.36,21.36,0,0,0,2.78-6,22,22,0,0,0,.93-6.08,14.94,14.94,0,0,0-.6-4.27,8.9,8.9,0,0,0-5.06-5.82,11,11,0,0,0-4.54-.86,11.59,11.59,0,0,0-6.45,1.8,16.35,16.35,0,0,0-4.65,4.54,20.61,20.61,0,0,0-2.81,6,23.25,23.25,0,0,0-.94,6.3A10.93,10.93,0,0,0,992.19,210.46Z" />
                    <path class="cls-1"
                      d="M1038.62,179.34l-1.88,8.32h.15a21.18,21.18,0,0,1,5.74-6.6,13.49,13.49,0,0,1,8.36-2.62,8,8,0,0,0,1.13-.08,2.9,2.9,0,0,1,1.12.08l-1.5,6.82a4.49,4.49,0,0,0-1-.07h-.9q-1.2,0-1.95,0a9.82,9.82,0,0,0-1.88.34,12.38,12.38,0,0,0-4.69,2.33,16.56,16.56,0,0,0-3.56,4,15.71,15.71,0,0,0-2,4.39c-.5,1.67-.9,3.24-1.2,4.69l-3.68,17.17h-6.3l8-38.77Z" />
                    <path class="cls-1"
                      d="M1103.94,164.56q7.88,0,11.4,3.38t3.53,9.45a14.08,14.08,0,0,1-2.74,8.28,12.49,12.49,0,0,1-3.19,3,10.55,10.55,0,0,1-4.27,1.62v.15a10.83,10.83,0,0,1,5.85,3.93,11.59,11.59,0,0,1,2.17,7.17,15.94,15.94,0,0,1-1.46,6.9,15.23,15.23,0,0,1-4,5.21,19.06,19.06,0,0,1-6,3.3,23.21,23.21,0,0,1-7.42,1.16h-26.48l11.18-53.55Zm-7.35,47.55a31.91,31.91,0,0,0,3.53-.26,12.71,12.71,0,0,0,4.27-1.35,10.58,10.58,0,0,0,3.64-3.19,9.62,9.62,0,0,0,1.54-5.77,8.29,8.29,0,0,0-.9-4.13,6.12,6.12,0,0,0-2.44-2.4,10.84,10.84,0,0,0-3.53-1.12,27.79,27.79,0,0,0-4.16-.3h-15.3l-3.9,18.52Zm3.75-24.52q11.4,0,11.4-10.2a6.17,6.17,0,0,0-1-3.75,6.31,6.31,0,0,0-2.59-2,11.47,11.47,0,0,0-3.41-.86,33.17,33.17,0,0,0-3.49-.19H1088l-3.6,17Z" />
                    <path class="cls-1" d="M1136.19,179.34l-8.1,38.77h-6.3l8-38.77Zm-5-7,1.65-7.8h6.45l-1.65,7.8Z" />
                    <path class="cls-1"
                      d="M1141.48,193.66a23.62,23.62,0,0,1,4.27-7.8,21.24,21.24,0,0,1,6.83-5.4,19.92,19.92,0,0,1,9.11-2q7.88,0,12,4.08t4.12,12a29.66,29.66,0,0,1-1.42,9.15,23.82,23.82,0,0,1-4.2,7.83,20.66,20.66,0,0,1-6.75,5.44,19.74,19.74,0,0,1-9.08,2,18.76,18.76,0,0,1-6.86-1.2,14.21,14.21,0,0,1-8.36-8.44,18.17,18.17,0,0,1-1.12-6.49A28.83,28.83,0,0,1,1141.48,193.66Zm7.61,16.8q2.7,2.92,8,2.93a10.8,10.8,0,0,0,6.19-1.8,16.76,16.76,0,0,0,4.5-4.54,21.33,21.33,0,0,0,2.77-6,21.66,21.66,0,0,0,.94-6.08,14.94,14.94,0,0,0-.6-4.27,9,9,0,0,0-5.06-5.82,11.08,11.08,0,0,0-4.54-.86,11.59,11.59,0,0,0-6.45,1.8,16.35,16.35,0,0,0-4.65,4.54,20.36,20.36,0,0,0-2.81,6,22.87,22.87,0,0,0-.94,6.3A10.93,10.93,0,0,0,1149.09,210.46Z" />
                    <path class="cls-1"
                      d="M1206.09,179.34l-1.2,5.62h-7.73l-4.8,22.8c0,.45-.1.88-.15,1.28a10.24,10.24,0,0,0-.07,1.27,2.07,2.07,0,0,0,1.16,2.06,6,6,0,0,0,2.66.57,9.59,9.59,0,0,0,1.88-.19,17.19,17.19,0,0,0,1.8-.49l-1.13,5.85c-.75.1-1.5.19-2.25.26a21.2,21.2,0,0,1-2.25.12,19.92,19.92,0,0,1-3.37-.27,7.61,7.61,0,0,1-2.74-1,5.52,5.52,0,0,1-1.87-1.91,5.93,5.93,0,0,1-.72-3.08,9.9,9.9,0,0,1,.12-1.57c.07-.5.16-1.05.26-1.65l5.1-24.08h-6.53l1.2-5.62H1192l2.4-11.48h6.37l-2.4,11.48Z" />
                    <path class="cls-1"
                      d="M1212.54,204a9.33,9.33,0,0,0,.82,4,8.21,8.21,0,0,0,2.25,2.93,11,11,0,0,0,3.23,1.8,11.28,11.28,0,0,0,3.75.64,12.12,12.12,0,0,0,7.05-1.92,11.23,11.23,0,0,0,4.12-5.51h6.38a16.72,16.72,0,0,1-2.4,5.66,15.2,15.2,0,0,1-4,4,17.44,17.44,0,0,1-5.17,2.44,21.47,21.47,0,0,1-6,.83,19.1,19.1,0,0,1-8-1.47,13.73,13.73,0,0,1-5.06-3.75,13.47,13.47,0,0,1-2.63-5,20,20,0,0,1-.75-5.29,30.71,30.71,0,0,1,1.61-10.16,25.31,25.31,0,0,1,4.36-7.91,19.32,19.32,0,0,1,6.37-5.1,16.93,16.93,0,0,1,7.61-1.8q8.55,0,12.49,4.5t3.94,12.67a17.32,17.32,0,0,1-.23,2.85c-.15.9-.27,1.63-.37,2.18h-29.18A24.88,24.88,0,0,0,1212.54,204Zm23.36-13a9.48,9.48,0,0,0-1.5-3.53,8,8,0,0,0-2.89-2.47,9.41,9.41,0,0,0-4.42-.94,13.74,13.74,0,0,0-5,.86,12.38,12.38,0,0,0-3.86,2.37,14.06,14.06,0,0,0-2.78,3.48,20.71,20.71,0,0,0-1.8,4.24h22.5A14.57,14.57,0,0,0,1235.9,191Z" />
                    <path class="cls-1"
                      d="M1274.71,186.05a8.54,8.54,0,0,0-6-2,12.6,12.6,0,0,0-6.49,1.65,15.46,15.46,0,0,0-4.72,4.28,19.2,19.2,0,0,0-2.89,5.88,22.39,22.39,0,0,0-1,6.42,18.44,18.44,0,0,0,.48,4.27,9.62,9.62,0,0,0,1.62,3.53,8,8,0,0,0,3,2.4,10.26,10.26,0,0,0,4.54.9,11.49,11.49,0,0,0,7-2.18,12.45,12.45,0,0,0,4.27-5.77h6.38a17.68,17.68,0,0,1-6.3,10.05,18.39,18.39,0,0,1-11.4,3.45q-8,0-12-4.35t-4-12.3a28.61,28.61,0,0,1,1.39-8.93,23.07,23.07,0,0,1,4.12-7.61,19.9,19.9,0,0,1,15.94-7.31q6.6,0,10.46,3.18t4.09,10h-6.37A7.19,7.19,0,0,0,1274.71,186.05Z" />
                    <path class="cls-1"
                      d="M1303.29,164.56,1298.71,185l.15.15a15.14,15.14,0,0,1,6.08-5.07,18.35,18.35,0,0,1,7.72-1.68q5.47,0,8.14,2.4t2.66,7.57a23.49,23.49,0,0,1-.3,3.3c-.2,1.35-.47,2.78-.82,4.28l-4.73,22.12h-6.37l5-22.65c0-.4.12-.86.22-1.39s.2-1.07.3-1.65.19-1.12.26-1.65a8.91,8.91,0,0,0,.12-1.31,4.59,4.59,0,0,0-1.95-4.09,8.44,8.44,0,0,0-4.8-1.31,11.75,11.75,0,0,0-5.22,1.28,14.81,14.81,0,0,0-4.38,3.22,10.53,10.53,0,0,0-2.7,3.64,26.79,26.79,0,0,0-1.58,4.46l-4.5,21.45h-6.3l11.25-53.55Z" />
                    <path class="cls-1"
                      d="M1341.61,179.34l-1.2,5.85h.15a15.14,15.14,0,0,1,6.08-5.07,18.35,18.35,0,0,1,7.72-1.68q5.48,0,8.14,2.4t2.66,7.57a23.49,23.49,0,0,1-.3,3.3c-.2,1.35-.47,2.78-.82,4.28l-4.73,22.12h-6.37l5-22.65c0-.4.12-.86.22-1.39s.2-1.07.3-1.65.19-1.12.26-1.65a8.91,8.91,0,0,0,.12-1.31,4.59,4.59,0,0,0-2-4.09,8.44,8.44,0,0,0-4.8-1.31,11.75,11.75,0,0,0-5.22,1.28,14.81,14.81,0,0,0-4.38,3.22,10.53,10.53,0,0,0-2.7,3.64,26.79,26.79,0,0,0-1.58,4.46l-4.5,21.45h-6.3l8.1-38.77Z" />
                    <path class="cls-1"
                      d="M1372.1,193.66a23.62,23.62,0,0,1,4.27-7.8,21.24,21.24,0,0,1,6.83-5.4,19.92,19.92,0,0,1,9.11-2q7.88,0,12,4.08t4.13,12a29.67,29.67,0,0,1-1.43,9.15,23.82,23.82,0,0,1-4.2,7.83,20.66,20.66,0,0,1-6.75,5.44,19.69,19.69,0,0,1-9.07,2,18.82,18.82,0,0,1-6.87-1.2,14.28,14.28,0,0,1-8.36-8.44,18.17,18.17,0,0,1-1.12-6.49A28.83,28.83,0,0,1,1372.1,193.66Zm7.61,16.8q2.7,2.92,8,2.93a10.8,10.8,0,0,0,6.19-1.8,16.76,16.76,0,0,0,4.5-4.54,21.33,21.33,0,0,0,2.77-6,21.66,21.66,0,0,0,.94-6.08,14.94,14.94,0,0,0-.6-4.27,8.9,8.9,0,0,0-5.06-5.82,11.08,11.08,0,0,0-4.54-.86,11.59,11.59,0,0,0-6.45,1.8,16.35,16.35,0,0,0-4.65,4.54,20.36,20.36,0,0,0-2.81,6,22.87,22.87,0,0,0-.94,6.3A10.93,10.93,0,0,0,1379.71,210.46Z" />
                    <path class="cls-1" d="M1429.66,164.56l-11.25,53.55h-6.3l11.18-53.55Z" />
                    <path class="cls-1"
                      d="M1431.8,193.66a23.62,23.62,0,0,1,4.27-7.8,21.24,21.24,0,0,1,6.83-5.4,19.92,19.92,0,0,1,9.11-2q7.88,0,12,4.08t4.12,12a29.66,29.66,0,0,1-1.42,9.15,23.82,23.82,0,0,1-4.2,7.83,20.66,20.66,0,0,1-6.75,5.44,19.74,19.74,0,0,1-9.08,2,18.76,18.76,0,0,1-6.86-1.2,14.21,14.21,0,0,1-8.36-8.44,18.17,18.17,0,0,1-1.13-6.49A28.83,28.83,0,0,1,1431.8,193.66Zm7.61,16.8q2.7,2.92,7.95,2.93a10.8,10.8,0,0,0,6.19-1.8,16.76,16.76,0,0,0,4.5-4.54,21.33,21.33,0,0,0,2.77-6,21.66,21.66,0,0,0,.94-6.08,14.94,14.94,0,0,0-.6-4.27,9,9,0,0,0-5.06-5.82,11.08,11.08,0,0,0-4.54-.86,11.59,11.59,0,0,0-6.45,1.8,16.35,16.35,0,0,0-4.65,4.54,20.36,20.36,0,0,0-2.81,6,22.87,22.87,0,0,0-.94,6.3A10.93,10.93,0,0,0,1439.41,210.46Z" />
                    <path class="cls-1"
                      d="M1505.11,218.22a42.28,42.28,0,0,1-1.58,4.77,16.38,16.38,0,0,1-6.9,8.32,21.65,21.65,0,0,1-10.72,2.48,23.88,23.88,0,0,1-5.74-.68,14.84,14.84,0,0,1-4.84-2.1,11.05,11.05,0,0,1-3.41-3.71,11.55,11.55,0,0,1-1.39-5.51h6.3a6.24,6.24,0,0,0,1,3.18,6.06,6.06,0,0,0,2.17,1.95,9.21,9.21,0,0,0,3,1,24,24,0,0,0,3.52.26,12.06,12.06,0,0,0,6-1.35,11.56,11.56,0,0,0,3.86-3.52,18.41,18.41,0,0,0,2.37-5c.57-1.88,1.11-3.76,1.61-5.66l-.15-.15a11.91,11.91,0,0,1-5.25,4.5,17.17,17.17,0,0,1-6.83,1.35,16,16,0,0,1-6.34-1.17,11.82,11.82,0,0,1-4.53-3.3,14.61,14.61,0,0,1-2.74-5.06,20.9,20.9,0,0,1-.94-6.45,27.41,27.41,0,0,1,1.39-8.55,25.65,25.65,0,0,1,4-7.69,20.83,20.83,0,0,1,6.33-5.55,16.87,16.87,0,0,1,8.48-2.13,15,15,0,0,1,4.16.56,15.29,15.29,0,0,1,3.68,1.57,10.67,10.67,0,0,1,2.85,2.48,8.52,8.52,0,0,1,1.61,3.26v.15h.15l1.2-7.12h6l-7,33.15Q1505.86,215.49,1505.11,218.22Zm-24.45-11.88a9.87,9.87,0,0,0,1.76,3.3,8.36,8.36,0,0,0,3,2.28,9.55,9.55,0,0,0,4.2.87,11,11,0,0,0,6.27-1.8,15.09,15.09,0,0,0,4.38-4.58,22.14,22.14,0,0,0,2.59-6,24.36,24.36,0,0,0,.86-6.18,10.75,10.75,0,0,0-2.43-7.35q-2.45-2.78-7.47-2.78a9.72,9.72,0,0,0-5.92,1.88,16.68,16.68,0,0,0-4.28,4.61,22.49,22.49,0,0,0-2.62,5.92,21.83,21.83,0,0,0-.9,5.89A13,13,0,0,0,1480.66,206.34Z" />
                    <path class="cls-1"
                      d="M1525,228.2a16.49,16.49,0,0,1-2.62,2.92,10.93,10.93,0,0,1-3.23,1.95,11.26,11.26,0,0,1-4.2.72,10.54,10.54,0,0,1-2.32-.27,8.76,8.76,0,0,1-2.1-.71l1.12-5.17a7.5,7.5,0,0,0,1.8.75,7.15,7.15,0,0,0,1.8.3,5.2,5.2,0,0,0,3.53-1.17,12.37,12.37,0,0,0,2.47-3l3.9-6.38-6.82-38.77h6.82l4.5,30.82h.15l16.28-30.82h7l-25.65,45.3C1526.58,225.89,1525.78,227.07,1525,228.2Z" />
                    <path class="cls-1" d="M1591,164.56l-11.25,53.55h-7.12l11.25-53.55Z" />
                    <path class="cls-1"
                      d="M1605.45,179.34l-1.2,5.85h.15a15.14,15.14,0,0,1,6.08-5.07,18.35,18.35,0,0,1,7.72-1.68c3.65,0,6.37.8,8.14,2.4s2.66,4.12,2.66,7.57a23.49,23.49,0,0,1-.3,3.3c-.2,1.35-.47,2.78-.82,4.28l-4.73,22.12h-6.37l5-22.65c0-.4.12-.86.22-1.39s.2-1.07.3-1.65.19-1.12.27-1.65a10.28,10.28,0,0,0,.11-1.31,4.59,4.59,0,0,0-2-4.09,8.44,8.44,0,0,0-4.8-1.31,11.67,11.67,0,0,0-5.21,1.28,14.73,14.73,0,0,0-4.39,3.22,10.53,10.53,0,0,0-2.7,3.64,26.79,26.79,0,0,0-1.58,4.46l-4.5,21.45h-6.3l8.1-38.77Z" />
                    <path class="cls-1"
                      d="M1635.53,185l1.12-5.62h6.6c.5-2,1-3.85,1.39-5.7a18.7,18.7,0,0,1,1.84-4.92,9.43,9.43,0,0,1,3.34-3.45,11.43,11.43,0,0,1,6-1.31c.9,0,1.8,0,2.7.11a13.47,13.47,0,0,1,2.62.49l-1,5.4c-.55-.1-1.07-.19-1.57-.26a9,9,0,0,0-1.43-.11,6.35,6.35,0,0,0-3.6.86,5.82,5.82,0,0,0-2,2.25,11.28,11.28,0,0,0-1,3.11c-.23,1.15-.52,2.33-.87,3.53H1657l-1,5.62h-7.5l-7.13,33.15h-6.37l7.2-33.15Z" />
                    <path class="cls-1"
                      d="M1658.14,193.66a23.64,23.64,0,0,1,4.28-7.8,21.21,21.21,0,0,1,6.82-5.4,20,20,0,0,1,9.11-2q7.88,0,12,4.08t4.13,12a29.67,29.67,0,0,1-1.43,9.15,23.82,23.82,0,0,1-4.2,7.83,20.66,20.66,0,0,1-6.75,5.44,19.69,19.69,0,0,1-9.07,2,18.72,18.72,0,0,1-6.86-1.2,14.26,14.26,0,0,1-8.37-8.44,18.17,18.17,0,0,1-1.12-6.49A29.11,29.11,0,0,1,1658.14,193.66Zm7.61,16.8q2.7,2.92,8,2.93a10.78,10.78,0,0,0,6.19-1.8,16.48,16.48,0,0,0,4.5-4.54,21.36,21.36,0,0,0,2.78-6,22,22,0,0,0,.93-6.08,14.94,14.94,0,0,0-.6-4.27,8.9,8.9,0,0,0-5.06-5.82,11,11,0,0,0-4.54-.86,11.59,11.59,0,0,0-6.45,1.8,16.35,16.35,0,0,0-4.65,4.54,20.61,20.61,0,0,0-2.81,6,23.25,23.25,0,0,0-.94,6.3A10.93,10.93,0,0,0,1665.75,210.46Z" />
                    <path class="cls-1"
                      d="M1712.18,179.34l-1.88,8.32h.15a21.18,21.18,0,0,1,5.74-6.6,13.51,13.51,0,0,1,8.36-2.62,8,8,0,0,0,1.13-.08,2.9,2.9,0,0,1,1.12.08l-1.5,6.82a4.49,4.49,0,0,0-1-.07h-.9q-1.2,0-2,0a9.82,9.82,0,0,0-1.88.34,12.27,12.27,0,0,0-4.68,2.33,16.39,16.39,0,0,0-3.57,4,15.71,15.71,0,0,0-2,4.39c-.5,1.67-.9,3.24-1.2,4.69l-3.68,17.17h-6.3l8-38.77Z" />
                    <path class="cls-1"
                      d="M1737.23,179.34l-1.43,5.77.15.15a18.56,18.56,0,0,1,6-5,16,16,0,0,1,7.54-1.83,12,12,0,0,1,6.3,1.57,7.83,7.83,0,0,1,3.45,5.4,16.69,16.69,0,0,1,5.82-5.06,15.48,15.48,0,0,1,7.46-1.91,16.53,16.53,0,0,1,4,.48,11.55,11.55,0,0,1,3.49,1.5,7.46,7.46,0,0,1,2.44,2.67,8.36,8.36,0,0,1,.9,4,23.25,23.25,0,0,1-.38,3.9c-.25,1.45-.5,2.72-.75,3.82l-4.87,23.25h-6.38l5.4-24.6a21.64,21.64,0,0,0,.41-2.14,13.51,13.51,0,0,0,.19-2.06,4.8,4.8,0,0,0-1.69-3.75,6.11,6.11,0,0,0-4.23-1.5,8.83,8.83,0,0,0-2.74.45,15,15,0,0,0-2.66,1.16,15,15,0,0,0-4.35,3.72,11,11,0,0,0-2.33,4,43.53,43.53,0,0,0-1.27,4.73l-4.28,20H1747l4.65-22.12c.35-1.5.64-2.9.86-4.2a20.19,20.19,0,0,0,.34-2.63,5,5,0,0,0-1.39-3.75,5.53,5.53,0,0,0-4-1.35,10.34,10.34,0,0,0-5.22,1.5,17.3,17.3,0,0,0-4.31,3.45,10.93,10.93,0,0,0-2.77,3.94,33.21,33.21,0,0,0-1.35,4.84l-4.35,20.32h-6.3l8.17-38.77Z" />
                    <path class="cls-1"
                      d="M1793.29,185.45a14.1,14.1,0,0,1,3.79-3.94,15.83,15.83,0,0,1,5.1-2.32,23.15,23.15,0,0,1,5.92-.75,31.06,31.06,0,0,1,5.4.45,13.69,13.69,0,0,1,4.5,1.57,8.55,8.55,0,0,1,3.11,3,9.13,9.13,0,0,1,1.17,4.84,16.68,16.68,0,0,1-.42,3.56c-.27,1.27-.53,2.44-.78,3.49L1818.6,206c-.15.8-.36,1.7-.64,2.7a11,11,0,0,0-.41,2.85,2.64,2.64,0,0,0,.53,1.88,1.82,1.82,0,0,0,1.35.52,3.12,3.12,0,0,0,1-.19l1-.33-1,4.72a12.34,12.34,0,0,1-1.92.56,8.91,8.91,0,0,1-2,.27,5.23,5.23,0,0,1-4-1.43,4.69,4.69,0,0,1-1-4l-.15-.15a13.35,13.35,0,0,1-5,4.12,18.69,18.69,0,0,1-8,1.43,17.94,17.94,0,0,1-4.62-.57,9.5,9.5,0,0,1-3.71-1.87,9.3,9.3,0,0,1-2.51-3.38,12.1,12.1,0,0,1-.94-5.06,10.71,10.71,0,0,1,1.84-6.67,11.57,11.57,0,0,1,4.69-3.64,23.14,23.14,0,0,1,6.3-1.69q3.45-.45,6.67-.75c1.7-.15,3.16-.31,4.39-.49a9.91,9.91,0,0,0,3-.86,3.81,3.81,0,0,0,1.76-1.72,7.06,7.06,0,0,0,.56-3.08,4.07,4.07,0,0,0-.75-2.55,5.39,5.39,0,0,0-1.87-1.54,8.85,8.85,0,0,0-2.52-.78,16.59,16.59,0,0,0-2.66-.23,17,17,0,0,0-3.56.38,10.28,10.28,0,0,0-3.19,1.23,8.35,8.35,0,0,0-2.4,2.18,7.13,7.13,0,0,0-1.27,3.19h-6.38A13.45,13.45,0,0,1,1793.29,185.45Zm1.8,26.59a8.86,8.86,0,0,0,4.84,1.35q7.58,0,10.87-5.1a12.73,12.73,0,0,0,2.14-4.73c.37-1.7.79-3.45,1.24-5.25H1814a8.74,8.74,0,0,1-3.42,1.39c-1.37.27-2.83.49-4.38.64s-3.12.33-4.69.56a18.11,18.11,0,0,0-4.24,1.09,7.84,7.84,0,0,0-3.07,2.13A6,6,0,0,0,1793,208,4.47,4.47,0,0,0,1795.09,212Z" />
                    <path class="cls-1"
                      d="M1850.55,179.34l-1.2,5.62h-7.72l-4.8,22.8c0,.45-.1.88-.15,1.28a10.18,10.18,0,0,0-.08,1.27,2.08,2.08,0,0,0,1.16,2.06,6,6,0,0,0,2.67.57,9.48,9.48,0,0,0,1.87-.19,17.19,17.19,0,0,0,1.8-.49l-1.12,5.85c-.75.1-1.5.19-2.25.26a21.2,21.2,0,0,1-2.25.12,20,20,0,0,1-3.38-.27,7.61,7.61,0,0,1-2.74-1,5.52,5.52,0,0,1-1.87-1.91,5.93,5.93,0,0,1-.71-3.08,9.92,9.92,0,0,1,.11-1.57c.07-.5.16-1.05.26-1.65l5.1-24.08h-6.52l1.2-5.62h6.52l2.4-11.48h6.38l-2.4,11.48Z" />
                    <path class="cls-1" d="M1864,179.34l-8.1,38.77h-6.3l8-38.77Zm-5-7,1.65-7.8h6.45l-1.65,7.8Z" />
                    <path class="cls-1"
                      d="M1869.26,193.66a23.64,23.64,0,0,1,4.28-7.8,21.21,21.21,0,0,1,6.82-5.4,20,20,0,0,1,9.11-2q7.88,0,12,4.08t4.13,12a29.67,29.67,0,0,1-1.43,9.15,23.82,23.82,0,0,1-4.2,7.83,20.66,20.66,0,0,1-6.75,5.44,19.69,19.69,0,0,1-9.07,2,18.72,18.72,0,0,1-6.86-1.2,14.26,14.26,0,0,1-8.37-8.44,18.17,18.17,0,0,1-1.12-6.49A29.11,29.11,0,0,1,1869.26,193.66Zm7.61,16.8q2.7,2.92,8,2.93a10.78,10.78,0,0,0,6.19-1.8,16.48,16.48,0,0,0,4.5-4.54,21.36,21.36,0,0,0,2.78-6,22,22,0,0,0,.93-6.08,14.94,14.94,0,0,0-.6-4.27,8.9,8.9,0,0,0-5.06-5.82,11,11,0,0,0-4.54-.86,11.59,11.59,0,0,0-6.45,1.8,16.35,16.35,0,0,0-4.65,4.54,20.61,20.61,0,0,0-2.81,6,23.25,23.25,0,0,0-.94,6.3A10.93,10.93,0,0,0,1876.87,210.46Z" />
                    <path class="cls-1"
                      d="M1923.52,179.34l-1.2,5.85h.15a15.14,15.14,0,0,1,6.08-5.07,18.35,18.35,0,0,1,7.72-1.68c3.65,0,6.37.8,8.14,2.4s2.66,4.12,2.66,7.57a23.49,23.49,0,0,1-.3,3.3c-.2,1.35-.47,2.78-.82,4.28l-4.73,22.12h-6.37l5-22.65c0-.4.12-.86.22-1.39s.2-1.07.3-1.65.19-1.12.27-1.65a10.28,10.28,0,0,0,.11-1.31,4.59,4.59,0,0,0-2-4.09,8.44,8.44,0,0,0-4.8-1.31,11.75,11.75,0,0,0-5.22,1.28,14.81,14.81,0,0,0-4.38,3.22,10.53,10.53,0,0,0-2.7,3.64,26.79,26.79,0,0,0-1.58,4.46l-4.5,21.45h-6.3l8.1-38.77Z" />
                  </g>
                </g>
              </svg>
            </a>
        </div>
        </div>
    </div>
</header>

<main id="main_content">
  <div class="grid-container">
    <h1 aria-label="400 Error">400</h1>
    <h2>bad request</h2>
    <p class="margin-bottom-3 mobile:margin-bottom-6">Sorry, something went wrong. Please try again later.</p>
    <p>Try one of these options instead:</p>
    <div class="margin-bottom-3 mobile:margin-bottom-6">
      <ul class="usa-list usa-list--unstyled flex-wrapper display-block tablet:display-flex">
        <li class="flex-child"><button class="usa-button" id="ncbiHomeBtn">NCBI Home</button></li>
        <li class="flex-child"><button class="usa-button" id="helpDeskBtn">Contact Help Desk</button></li>
        <li class="flex-child flex-fill">
          <form class="usa-search" role="search" method="get" action="https://www.ncbi.nlm.nih.gov/search/all">
            <input class="usa-input" id="basic-search-field-medium" type="search" name="term" placeholder="Search NCBI" aria-label="Search NCBI">
            <button class="usa-button usa-button__reset" type="reset"></button>
            <button class="usa-button usa-button__search" type="submit" aria-label="Search" data-section="link_click" data-ga-action="search_ncbi" data-ga-label="NONE">
              <span aria-hidden="true">Search</span>
            </button>
          </form>
        </li>
      </ul>
    </div>
  </div>
</main>

<footer>
  <section class="icon-section">
    <div id="icon-section-header" class="icon-section_header">Follow NCBI</div>
    <div class="grid-container container">
      <div class="icon-section_container">
        <a class="footer-icon" id="footer_twitter" href="https://twitter.com/ncbi" aria-label="Twitter"><svg
            data-name="Layer 1" xmlns="http://www.w3.org/2000/svg" viewBox="0 0 300 300">
            <defs>
              <style>
                .cls-11 {
                  fill: #737373;
                }
              </style>
            </defs>
            <title>Twitter</title>
            <path class="cls-11"
              d="M250.11,105.48c-7,3.14-13,3.25-19.27.14,8.12-4.86,8.49-8.27,11.43-17.46a78.8,78.8,0,0,1-25,9.55,39.35,39.35,0,0,0-67,35.85,111.6,111.6,0,0,1-81-41.08A39.37,39.37,0,0,0,81.47,145a39.08,39.08,0,0,1-17.8-4.92c0,.17,0,.33,0,.5a39.32,39.32,0,0,0,31.53,38.54,39.26,39.26,0,0,1-17.75.68,39.37,39.37,0,0,0,36.72,27.3A79.07,79.07,0,0,1,56,223.34,111.31,111.31,0,0,0,116.22,241c72.3,0,111.83-59.9,111.83-111.84,0-1.71,0-3.4-.1-5.09C235.62,118.54,244.84,113.37,250.11,105.48Z">
            </path>
          </svg></a>
        <a class="footer-icon" id="footer_facebook" href="https://www.facebook.com/ncbi.nlm" aria-label="Facebook"><svg
            data-name="Layer 1" xmlns="http://www.w3.org/2000/svg" viewBox="0 0 300 300">
            <title>Facebook</title>
            <path class="cls-11"
              d="M210.5,115.12H171.74V97.82c0-8.14,5.39-10,9.19-10h27.14V52l-39.32-.12c-35.66,0-42.42,26.68-42.42,43.77v19.48H99.09v36.32h27.24v109h45.41v-109h35Z">
            </path>
          </svg></a>
        <a class="footer-icon" id="footer_linkedin"
          href="https://www.linkedin.com/company/ncbinlm"
          aria-label="LinkedIn"><svg data-name="Layer 1" xmlns="http://www.w3.org/2000/svg" viewBox="0 0 300 300">
            <title>LinkedIn</title>
            <path class="cls-11"
              d="M101.64,243.37H57.79v-114h43.85Zm-22-131.54h-.26c-13.25,0-21.82-10.36-21.82-21.76,0-11.65,8.84-21.15,22.33-21.15S101.7,78.72,102,90.38C102,101.77,93.4,111.83,79.63,111.83Zm100.93,52.61A17.54,17.54,0,0,0,163,182v61.39H119.18s.51-105.23,0-114H163v13a54.33,54.33,0,0,1,34.54-12.66c26,0,44.39,18.8,44.39,55.29v58.35H198.1V182A17.54,17.54,0,0,0,180.56,164.44Z">
            </path>
          </svg></a>
        <a class="footer-icon" id="footer_github" href="https://github.com/ncbi" aria-label="GitHub"><svg
            data-name="Layer 1" xmlns="http://www.w3.org/2000/svg" viewBox="0 0 300 300">
            <defs>
              <style>
                .cls-11,
                .cls-12 {
                  fill: #737373;
                }

                .cls-11 {
                  fill-rule: evenodd;
                }
              </style>
            </defs>
            <title>GitHub</title>
            <path class="cls-11"
              d="M151.36,47.28a105.76,105.76,0,0,0-33.43,206.1c5.28,1,7.22-2.3,7.22-5.09,0-2.52-.09-10.85-.14-19.69-29.42,6.4-35.63-12.48-35.63-12.48-4.81-12.22-11.74-15.47-11.74-15.47-9.59-6.56.73-6.43.73-6.43,10.61.75,16.21,10.9,16.21,10.9,9.43,16.17,24.73,11.49,30.77,8.79,1-6.83,3.69-11.5,6.71-14.14C108.57,197.1,83.88,188,83.88,147.51a40.92,40.92,0,0,1,10.9-28.39c-1.1-2.66-4.72-13.42,1-28,0,0,8.88-2.84,29.09,10.84a100.26,100.26,0,0,1,53,0C198,88.3,206.9,91.14,206.9,91.14c5.76,14.56,2.14,25.32,1,28a40.87,40.87,0,0,1,10.89,28.39c0,40.62-24.74,49.56-48.29,52.18,3.79,3.28,7.17,9.71,7.17,19.58,0,14.15-.12,25.54-.12,29,0,2.82,1.9,6.11,7.26,5.07A105.76,105.76,0,0,0,151.36,47.28Z">
            </path>
            <path class="cls-12"
              d="M85.66,199.12c-.23.52-1.06.68-1.81.32s-1.2-1.06-.95-1.59,1.06-.69,1.82-.33,1.21,1.07.94,1.6Zm-1.3-1">
            </path>
            <path class="cls-12"
              d="M90,203.89c-.51.47-1.49.25-2.16-.49a1.61,1.61,0,0,1-.31-2.19c.52-.47,1.47-.25,2.17.49s.82,1.72.3,2.19Zm-1-1.08">
            </path>
            <path class="cls-12"
              d="M94.12,210c-.65.46-1.71,0-2.37-.91s-.64-2.07,0-2.52,1.7,0,2.36.89.65,2.08,0,2.54Zm0,0"></path>
            <path class="cls-12"
              d="M99.83,215.87c-.58.64-1.82.47-2.72-.41s-1.18-2.06-.6-2.7,1.83-.46,2.74.41,1.2,2.07.58,2.7Zm0,0">
            </path>
            <path class="cls-12"
              d="M107.71,219.29c-.26.82-1.45,1.2-2.64.85s-2-1.34-1.74-2.17,1.44-1.23,2.65-.85,2,1.32,1.73,2.17Zm0,0">
            </path>
            <path class="cls-12"
              d="M116.36,219.92c0,.87-1,1.59-2.24,1.61s-2.29-.68-2.3-1.54,1-1.59,2.26-1.61,2.28.67,2.28,1.54Zm0,0">
            </path>
            <path class="cls-12"
              d="M124.42,218.55c.15.85-.73,1.72-2,1.95s-2.37-.3-2.52-1.14.73-1.75,2-2,2.37.29,2.53,1.16Zm0,0"></path>
          </svg></a>
        <a class="footer-icon" id="footer_blog" href="https://ncbiinsights.ncbi.nlm.nih.gov/" aria-label="Blog">
          <svg id="Layer_1" data-name="Layer 1" xmlns="http://www.w3.org/2000/svg" viewBox="0 0 40 40"><defs><style>.cls-13{fill:#737373;}</style></defs><path class="cls-13" d="M14,30a4,4,0,1,1-4-4,4,4,0,0,1,4,4Zm11,3A19,19,0,0,0,7.05,15a1,1,0,0,0-1,1v3a1,1,0,0,0,.93,1A14,14,0,0,1,20,33.07,1,1,0,0,0,21,34h3a1,1,0,0,0,1-1Zm9,0A28,28,0,0,0,7,6,1,1,0,0,0,6,7v3a1,1,0,0,0,1,1A23,23,0,0,1,29,33a1,1,0,0,0,1,1h3A1,1,0,0,0,34,33Z"/></svg>
        </a>
      </div>
    </div>
  </section>

  <section class="container-fluid bg-primary">
    <div class="container pt-5">
      <div class="row mt-3">
        <div class="col-lg-3 col-12">
          <p><a class="text-white" href="https://www.nlm.nih.gov/socialmedia/index.html">Connect with NLM</a></p>
          <ul class="list-inline social_media">
            <li class="list-inline-item"><a href="https://twitter.com/NLM_NIH" aria-label="Twitter"
                target="_blank" rel="noopener noreferrer"><svg version="1.1" xmlns="http://www.w3.org/2000/svg"
                  xmlns:xlink="http://www.w3.org/1999/xlink" x="0px" y="0px" viewBox="0 0 249 249"
                  style="enable-background:new 0 0 249 249;" xml:space="preserve">
                  <style type="text/css">
                    .st20 {
                      fill: #FFFFFF;
                    }

                    .st30 {
                      fill: none;
                      stroke: #FFFFFF;
                      stroke-width: 8;
                      stroke-miterlimit: 10;
                    }
                  </style>
                  <title>SM-Twitter</title>
                  <g>
                    <g>
                      <g>
                        <path class="st20" d="M192.9,88.1c-5,2.2-9.2,2.3-13.6,0.1c5.7-3.4,6-5.8,8.1-12.3c-5.4,3.2-11.4,5.5-17.6,6.7
                                            c-10.5-11.2-28.1-11.7-39.2-1.2c-7.2,6.8-10.2,16.9-8,26.5c-22.3-1.1-43.1-11.7-57.2-29C58,91.6,61.8,107.9,74,116
                                            c-4.4-0.1-8.7-1.3-12.6-3.4c0,0.1,0,0.2,0,0.4c0,13.2,9.3,24.6,22.3,27.2c-4.1,1.1-8.4,1.3-12.5,0.5c3.6,11.3,14,19,25.9,19.3
                                            c-11.6,9.1-26.4,13.2-41.1,11.5c12.7,8.1,27.4,12.5,42.5,12.5c51,0,78.9-42.2,78.9-78.9c0-1.2,0-2.4-0.1-3.6
                                            C182.7,97.4,189.2,93.7,192.9,88.1z"></path>
                      </g>
                    </g>
                    <circle class="st30" cx="124.4" cy="128.8" r="108.2"></circle>
                  </g>
                </svg></a></li>
            <li class="list-inline-item"><a href="https://www.facebook.com/nationallibraryofmedicine"
                aria-label="Facebook" rel="noopener noreferrer" target="_blank">
                <svg version="1.1" xmlns="http://www.w3.org/2000/svg" xmlns:xlink="http://www.w3.org/1999/xlink" x="0px"
                  y="0px" viewBox="0 0 249 249" style="enable-background:new 0 0 249 249;" xml:space="preserve">
                  <style type="text/css">
                    .st10 {
                      fill: #FFFFFF;
                    }

                    .st110 {
                      fill: none;
                      stroke: #FFFFFF;
                      stroke-width: 8;
                      stroke-miterlimit: 10;
                    }
                  </style>
                  <title>SM-Facebook</title>
                  <g>
                    <g>
                      <path class="st10" d="M159,99.1h-24V88.4c0-5,3.3-6.2,5.7-6.2h16.8V60l-24.4-0.1c-22.1,0-26.2,16.5-26.2,27.1v12.1H90v22.5h16.9
                                                  v67.5H135v-67.5h21.7L159,99.1z"></path>
                    </g>
                  </g>
                  <circle class="st110" cx="123.6" cy="123.2" r="108.2"></circle>
                </svg>
              </a></li>
            <li class="list-inline-item"><a href="https://www.youtube.com/user/NLMNIH" aria-label="Youtube"
                target="_blank" rel="noopener noreferrer"><svg version="1.1" xmlns="http://www.w3.org/2000/svg"
                  xmlns:xlink="http://www.w3.org/1999/xlink" x="0px" y="0px" viewBox="0 0 249 249"
                  style="enable-background:new 0 0 249 249;" xml:space="preserve">
                  <title>SM-Youtube</title>
                  <style type="text/css">
                    .st4 {
                      fill: none;
                      stroke: #FFFFFF;
                      stroke-width: 8;
                      stroke-miterlimit: 10;
                    }

                    .st5 {
                      fill: #FFFFFF;
                    }
                  </style>
                  <circle class="st4" cx="124.2" cy="123.4" r="108.2"></circle>
                  <g transform="translate(0,-952.36218)">
                    <path class="st5"
                      d="M88.4,1037.4c-10.4,0-18.7,8.3-18.7,18.7v40.1c0,10.4,8.3,18.7,18.7,18.7h72.1c10.4,0,18.7-8.3,18.7-18.7
                                        v-40.1c0-10.4-8.3-18.7-18.7-18.7H88.4z M115.2,1058.8l29.4,17.4l-29.4,17.4V1058.8z"></path>
                  </g>
                </svg></a></li>
          </ul>
        </div>
        <div class="col-lg-3 col-12">
          <p class="address_footer text-white">National Library of Medicine<br>
            <a href="https://www.google.com/maps/place/8600+Rockville+Pike,+Bethesda,+MD+20894/@38.9959508,-77.101021,17z/data=!3m1!4b1!4m5!3m4!1s0x89b7c95e25765ddb:0x19156f88b27635b8!8m2!3d38.9959508!4d-77.0988323"
              class="text-white" target="_blank" rel="noopener noreferrer">8600 Rockville Pike<br>
              Bethesda, MD 20894</a></p>
        </div>
        <div class="col-lg-3 col-12 centered-lg">
          <p><a href="https://www.nlm.nih.gov/web_policies.html" class="text-white">Web Policies</a><br>
            <a href="https://www.nih.gov/institutes-nih/nih-office-director/office-communications-public-liaison/freedom-information-act-office"
              class="text-white">FOIA</a><br>
            <a href="https://www.hhs.gov/vulnerability-disclosure-policy/index.html" class="text-white" id="vdp">HHS Vulnerability Disclosure</a></p>
        </div>
        <div class="col-lg-3 col-12 centered-lg">
          <p><a class="supportLink text-white" href="https://support.nlm.nih.gov/">Help</a><br>
            <a href="https://www.nlm.nih.gov/accessibility.html" class="text-white">Accessibility</a><br>
            <a href="https://www.nlm.nih.gov/careers/careers.html" class="text-white">Careers</a></p>
        </div>
      </div>
      <div class="row">
        <div class="col-lg-12 centered-lg">
          <nav class="bottom-links">
            <ul class="mt-3">
              <li>
                <a class="text-white" href="//www.nlm.nih.gov/">NLM</a>
              </li>
              <li>
                <a class="text-white"
              href="https://www.nih.gov/">NIH</a>
              </li>
              <li>
                <a class="text-white" href="https://www.hhs.gov/">HHS</a>
              </li>
              <li>
                <a
              class="text-white" href="https://www.usa.gov/">USA.gov</a>
              </li>
            </ul>
          </nav>
        </div>
      </div>
    </div>
  </section>
</footer>

</body>
<script>
  const userEvents =  ['click', 'keypress'];
  for (let i = 0; i < userEvents.length; i++) {
    let evt = userEvents[i];
    document.querySelector('#icon-section-header').addEventListener(evt, function(e){
      if (document.body.clientWidth < 993) {
        classToggle(e.target);
      }
    });
  }
  function classToggle(elm) {
    elm.classList.toggle('opened');
  }
  let helpDeskBtn = document.querySelector('#helpDeskBtn');
  if (!!helpDeskBtn) {
    let helpDeskLink = 'https://support.nlm.nih.gov/support/create-case?from=' + encodeURIComponent(window.location.href);
    helpDeskBtn.addEventListener('click',  function(){
      window.open(helpDeskLink, '_blank')
    });
  }
  let ncbiHomeBtn = document.querySelector('#ncbiHomeBtn');
  if (!!ncbiHomeBtn) {
    ncbiHomeBtn.addEventListener('click', function(){
      window.open('https://www.ncbi.nlm.nih.gov', '_blank')
    });
  }
  // Following JavaScript is to toggle top banner of page.
  var head_bnr = document.querySelector(".usa-banner header.usa-banner-header");
  var btn_bnr = document.querySelector(".usa-banner button.usa-accordion-button.usa-banner-button");
  var acr_bnr = document.querySelector(".usa-banner div.usa-banner-content.usa-accordion-content");
  btn_bnr.addEventListener("click", function(e) {
    head_bnr.classList.toggle("usa-banner-header-expanded");
    var aria_val = this.getAttribute("aria-expanded");
    var opp_aria_val = (aria_val === "false") ? "true" : "false";
    this.setAttribute("aria-expanded", opp_aria_val);
    acr_bnr.setAttribute("aria-hidden", aria_val);
    e.stopPropagation();
  });
</script>
</html>

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.