Viewing data for Rucervus duvaucelii


Scientific name Rucervus duvaucelii
Common name Barasingha
Maximum lifespan 24.50 years (Rucervus duvaucelii@AnAge)

Total mtDNA (size: 16342 bases) GC AT G C A T
Base content (bases) 6166 10176 3988 2178 4723 5453
Base content per 1 kb (bases) 377 623 244 133 289 334
Base content (%) 37.7% 62.3%
Total protein-coding genes (size: 11338 bases) GC AT G C A T
Base content (bases) 4294 7044 2925 1369 3384 3660
Base content per 1 kb (bases) 379 621 258 121 298 323
Base content (%) 37.9% 62.1%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1514 bases) GC AT G C A T
Base content (bases) 547 967 314 233 423 544
Base content per 1 kb (bases) 361 639 207 154 279 359
Base content (%) 36.1% 63.9%
Total rRNA-coding genes (size: 2527 bases) GC AT G C A T
Base content (bases) 962 1565 524 438 613 952
Base content per 1 kb (bases) 381 619 207 173 243 377
Base content (%) 38.1% 61.9%
12S rRNA gene (size: 956 bases) GC AT G C A T
Base content (bases) 378 578 209 169 224 354
Base content per 1 kb (bases) 395 605 219 177 234 370
Base content (%) 39.5% 60.5%
16S rRNA gene (size: 1571 bases) GC AT G C A T
Base content (bases) 584 987 315 269 389 598
Base content per 1 kb (bases) 372 628 201 171 248 381
Base content (%) 37.2% 62.8%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 257 424 175 82 210 214
Base content per 1 kb (bases) 377 623 257 120 308 314
Base content (%) 37.7% 62.3%
ATP8 (size: 201 bases) GC AT G C A T
Base content (bases) 60 141 47 13 60 81
Base content per 1 kb (bases) 299 701 234 65 299 403
Base content (%) 29.9% 70.1%
COX1 (size: 1545 bases) GC AT G C A T
Base content (bases) 610 935 355 255 496 439
Base content per 1 kb (bases) 395 605 230 165 321 284
Base content (%) 39.5% 60.5%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 254 430 155 99 197 233
Base content per 1 kb (bases) 371 629 227 145 288 341
Base content (%) 37.1% 62.9%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 329 455 220 109 235 220
Base content per 1 kb (bases) 420 580 281 139 300 281
Base content (%) 42.0% 58.0%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 467 673 311 156 327 346
Base content per 1 kb (bases) 410 590 273 137 287 304
Base content (%) 41.0% 59.0%
ND1 (size: 956 bases) GC AT G C A T
Base content (bases) 368 588 254 114 284 304
Base content per 1 kb (bases) 385 615 266 119 297 318
Base content (%) 38.5% 61.5%
ND2 (size: 1042 bases) GC AT G C A T
Base content (bases) 356 686 270 86 300 386
Base content per 1 kb (bases) 342 658 259 83 288 370
Base content (%) 34.2% 65.8%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 130 216 90 40 107 109
Base content per 1 kb (bases) 376 624 260 116 309 315
Base content (%) 37.6% 62.4%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 523 855 370 153 419 436
Base content per 1 kb (bases) 380 620 269 111 304 316
Base content (%) 38.0% 62.0%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 105 192 68 37 99 93
Base content per 1 kb (bases) 354 646 229 125 333 313
Base content (%) 35.4% 64.6%
ND5 (size: 1821 bases) GC AT G C A T
Base content (bases) 663 1158 473 190 550 608
Base content per 1 kb (bases) 364 636 260 104 302 334
Base content (%) 36.4% 63.6%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 190 338 149 41 123 215
Base content per 1 kb (bases) 360 640 282 78 233 407
Base content (%) 36.0% 64.0%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (5.31%)
Alanine (Ala, A)
n = 19 (8.41%)
Serine (Ser, S)
n = 13 (5.75%)
Threonine (Thr, T)
n = 23 (10.18%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 11 (4.87%)
Leucine (Leu, L)
n = 43 (19.03%)
Isoleucine (Ile, I)
n = 22 (9.73%)
Methionine (Met, M)
n = 14 (6.19%)
Proline (Pro, P)
n = 12 (5.31%)
Phenylalanine (Phe, F)
n = 13 (5.75%)
Tyrosine (Tyr, Y)
n = 2 (0.88%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 12 (5.31%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 6 (2.65%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 4 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 5 12 12 4 16 3 7 9 0 2 2 6 1 11 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 4 8 7 0 0 4 6 2 2 2 8 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 13 0 1 3 4 1 2 2 0 2 1 1 8 4 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 3 0 0 1 2 2 2 1 1 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
46 66 79 36
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
23 63 38 103
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 46 97 71
ATP8 (size: 201 bases)
Amino acid sequence: MPQLDTSTWLMMILSMFLALFIIFQLKISKHNFHFNPELTLTKTQKQDTPWETKWTKIYLPLLLPQ*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 1 (1.52%)
Serine (Ser, S)
n = 3 (4.55%)
Threonine (Thr, T)
n = 8 (12.12%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 12 (18.18%)
Isoleucine (Ile, I)
n = 5 (7.58%)
Methionine (Met, M)
n = 4 (6.06%)
Proline (Pro, P)
n = 5 (7.58%)
Phenylalanine (Phe, F)
n = 5 (7.58%)
Tyrosine (Tyr, Y)
n = 1 (1.52%)
Tryptophan (Trp, W)
n = 3 (4.55%)
Aspartic acid (Asp, D)
n = 2 (3.03%)
Glutamic acid (Glu, E)
n = 2 (3.03%)
Asparagine (Asn, N)
n = 2 (3.03%)
Glutamine (Gln, Q)
n = 5 (7.58%)
Histidine (His, H)
n = 2 (3.03%)
Lysine (Lys, K)
n = 6 (9.09%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 0 3 2 1 4 1 3 5 0 0 0 0 0 3 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 1 0 0 0 0 0 0 0 2 1 2 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 5 1 0 1 2 0 0 0 1 0 0 1 1 1 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 0 2 5 1 0 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
5 20 25 17
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
3 17 21 26
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 10 35 17
COX1 (size: 1545 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.14%)
Alanine (Ala, A)
n = 39 (7.59%)
Serine (Ser, S)
n = 31 (6.03%)
Threonine (Thr, T)
n = 37 (7.2%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 38 (7.39%)
Leucine (Leu, L)
n = 59 (11.48%)
Isoleucine (Ile, I)
n = 39 (7.59%)
Methionine (Met, M)
n = 33 (6.42%)
Proline (Pro, P)
n = 28 (5.45%)
Phenylalanine (Phe, F)
n = 42 (8.17%)
Tyrosine (Tyr, Y)
n = 19 (3.7%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 15 (2.92%)
Glutamic acid (Glu, E)
n = 10 (1.95%)
Asparagine (Asn, N)
n = 19 (3.7%)
Glutamine (Gln, Q)
n = 6 (1.17%)
Histidine (His, H)
n = 17 (3.31%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
28 11 24 5 9 18 6 19 5 1 12 6 20 0 26 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 0 1 15 9 13 2 7 14 19 7 10 8 10 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 21 1 7 7 14 0 1 2 13 6 1 2 11 8 8
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 9 1 5 10 9 0 1 2 5 0 0 0 1 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
149 97 140 129
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 132 96 211
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
30 126 203 156
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 8 (3.52%)
Serine (Ser, S)
n = 21 (9.25%)
Threonine (Thr, T)
n = 18 (7.93%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 13 (5.73%)
Leucine (Leu, L)
n = 34 (14.98%)
Isoleucine (Ile, I)
n = 18 (7.93%)
Methionine (Met, M)
n = 15 (6.61%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 6 (2.64%)
Tyrosine (Tyr, Y)
n = 11 (4.85%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 10 (4.41%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 6 (2.64%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 7 (3.08%)
Lysine (Lys, K)
n = 5 (2.2%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 7 11 3 2 15 2 12 4 2 5 1 7 0 3 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 2 2 3 3 0 1 2 4 1 3 3 7 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 12 2 7 2 6 1 2 3 9 2 0 0 2 4 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 10 5 3 7 4 1 0 1 4 1 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
54 54 67 53
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 55 61 86
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 46 105 58
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 15 (5.77%)
Serine (Ser, S)
n = 20 (7.69%)
Threonine (Thr, T)
n = 23 (8.85%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 15 (5.77%)
Leucine (Leu, L)
n = 32 (12.31%)
Isoleucine (Ile, I)
n = 16 (6.15%)
Methionine (Met, M)
n = 10 (3.85%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 7 (2.69%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 6 9 6 3 13 0 9 7 0 4 6 5 0 10 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 2 5 7 3 0 2 9 8 1 0 6 6 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 11 0 5 2 8 0 2 3 4 7 0 1 1 6 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 7 1 2 1 2 0 0 3 2 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
61 63 63 74
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 65 55 97
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 92 102 63
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.33%)
Alanine (Ala, A)
n = 23 (6.07%)
Serine (Ser, S)
n = 22 (5.8%)
Threonine (Thr, T)
n = 25 (6.6%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 19 (5.01%)
Leucine (Leu, L)
n = 57 (15.04%)
Isoleucine (Ile, I)
n = 42 (11.08%)
Methionine (Met, M)
n = 15 (3.96%)
Proline (Pro, P)
n = 23 (6.07%)
Phenylalanine (Phe, F)
n = 29 (7.65%)
Tyrosine (Tyr, Y)
n = 15 (3.96%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 18 (4.75%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 11 (2.9%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
26 16 12 5 14 30 3 4 6 0 3 8 6 2 12 17
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 3 2 3 18 0 1 6 13 4 1 7 13 2 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 15 1 7 2 10 0 1 2 3 12 1 1 7 11 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 4 2 6 5 7 2 1 0 7 0 1 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
83 100 113 84
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 90 76 162
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 121 157 81
ND1 (size: 956 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.79%)
Alanine (Ala, A)
n = 28 (8.83%)
Serine (Ser, S)
n = 24 (7.57%)
Threonine (Thr, T)
n = 18 (5.68%)
Cysteine (Cys, C)
n = 1 (0.32%)
Valine (Val, V)
n = 14 (4.42%)
Leucine (Leu, L)
n = 54 (17.03%)
Isoleucine (Ile, I)
n = 33 (10.41%)
Methionine (Met, M)
n = 19 (5.99%)
Proline (Pro, P)
n = 22 (6.94%)
Phenylalanine (Phe, F)
n = 21 (6.62%)
Tyrosine (Tyr, Y)
n = 11 (3.47%)
Tryptophan (Trp, W)
n = 9 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.95%)
Glutamic acid (Glu, E)
n = 11 (3.47%)
Asparagine (Asn, N)
n = 13 (4.1%)
Glutamine (Gln, Q)
n = 7 (2.21%)
Histidine (His, H)
n = 3 (0.95%)
Lysine (Lys, K)
n = 7 (2.21%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 12 15 4 6 32 1 10 7 0 2 3 7 2 11 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 2 10 14 2 1 4 7 0 6 7 9 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 14 0 3 8 10 0 0 3 7 4 0 1 8 5 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 9 2 0 3 7 0 0 2 5 1 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 83 93 74
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 89 55 141
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 82 155 68
ND2 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 16 (4.62%)
Serine (Ser, S)
n = 28 (8.09%)
Threonine (Thr, T)
n = 39 (11.27%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 13 (3.76%)
Leucine (Leu, L)
n = 54 (15.61%)
Isoleucine (Ile, I)
n = 36 (10.4%)
Methionine (Met, M)
n = 42 (12.14%)
Proline (Pro, P)
n = 20 (5.78%)
Phenylalanine (Phe, F)
n = 14 (4.05%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 16 (4.62%)
Glutamine (Gln, Q)
n = 10 (2.89%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 13 (3.76%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 15 40 4 10 33 0 6 10 0 7 2 3 1 8 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 1 7 7 1 1 4 9 0 1 8 11 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 17 1 8 2 16 0 0 2 4 4 1 1 7 9 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 0 2 0 12 1 0 0 3 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
49 85 148 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 101 58 159
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 84 180 75
ND3 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 16 (4.62%)
Serine (Ser, S)
n = 28 (8.09%)
Threonine (Thr, T)
n = 39 (11.27%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 13 (3.76%)
Leucine (Leu, L)
n = 54 (15.61%)
Isoleucine (Ile, I)
n = 36 (10.4%)
Methionine (Met, M)
n = 42 (12.14%)
Proline (Pro, P)
n = 20 (5.78%)
Phenylalanine (Phe, F)
n = 14 (4.05%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 16 (4.62%)
Glutamine (Gln, Q)
n = 10 (2.89%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 13 (3.76%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 15 40 4 10 33 0 6 10 0 7 2 3 1 8 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 1 7 7 1 1 4 9 0 1 8 11 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 17 1 8 2 16 0 0 2 4 4 1 1 7 9 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 0 2 0 12 1 0 0 3 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
49 85 148 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 101 58 159
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 84 180 75
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.93%)
Alanine (Ala, A)
n = 27 (5.9%)
Serine (Ser, S)
n = 40 (8.73%)
Threonine (Thr, T)
n = 36 (7.86%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 18 (3.93%)
Leucine (Leu, L)
n = 93 (20.31%)
Isoleucine (Ile, I)
n = 39 (8.52%)
Methionine (Met, M)
n = 35 (7.64%)
Proline (Pro, P)
n = 20 (4.37%)
Phenylalanine (Phe, F)
n = 22 (4.8%)
Tyrosine (Tyr, Y)
n = 17 (3.71%)
Tryptophan (Trp, W)
n = 13 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 9 (1.97%)
Asparagine (Asn, N)
n = 23 (5.02%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 11 (2.4%)
Lysine (Lys, K)
n = 11 (2.4%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
27 12 29 14 15 36 3 23 10 1 5 4 8 1 10 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 3 5 12 10 0 1 8 9 0 5 6 8 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 19 0 5 12 11 1 2 9 11 6 2 2 5 18 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 8 1 0 3 7 4 0 2 7 1 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
75 120 155 109
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
55 112 85 207
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
23 138 196 102
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 9 (9.18%)
Serine (Ser, S)
n = 10 (10.2%)
Threonine (Thr, T)
n = 5 (5.1%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 7 (7.14%)
Leucine (Leu, L)
n = 22 (22.45%)
Isoleucine (Ile, I)
n = 4 (4.08%)
Methionine (Met, M)
n = 12 (12.24%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 4 (4.08%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 5 (5.1%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 0 10 4 1 10 1 6 2 0 0 3 3 1 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 3 0 3 6 0 1 0 3 0 1 0 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 3 0 2 4 2 1 0 1 4 0 0 0 1 4 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 0 1 0 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
23 22 27 27
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 24 17 49
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 22 49 23
ND5 (size: 1821 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (4.62%)
Alanine (Ala, A)
n = 41 (6.77%)
Serine (Ser, S)
n = 49 (8.09%)
Threonine (Thr, T)
n = 54 (8.91%)
Cysteine (Cys, C)
n = 4 (0.66%)
Valine (Val, V)
n = 14 (2.31%)
Leucine (Leu, L)
n = 85 (14.03%)
Isoleucine (Ile, I)
n = 66 (10.89%)
Methionine (Met, M)
n = 41 (6.77%)
Proline (Pro, P)
n = 25 (4.13%)
Phenylalanine (Phe, F)
n = 49 (8.09%)
Tyrosine (Tyr, Y)
n = 18 (2.97%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 11 (1.82%)
Glutamic acid (Glu, E)
n = 11 (1.82%)
Asparagine (Asn, N)
n = 37 (6.11%)
Glutamine (Gln, Q)
n = 19 (3.14%)
Histidine (His, H)
n = 12 (1.98%)
Lysine (Lys, K)
n = 22 (3.63%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
41 25 39 14 11 36 7 17 18 1 2 3 9 0 18 31
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 3 6 17 17 1 6 8 12 2 11 5 9 0 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 30 1 12 10 13 1 3 10 10 8 1 0 16 21 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 9 2 4 7 20 2 0 5 3 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
105 132 233 137
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
65 156 131 255
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 185 244 158
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (14.86%)
Alanine (Ala, A)
n = 6 (3.43%)
Serine (Ser, S)
n = 11 (6.29%)
Threonine (Thr, T)
n = 10 (5.71%)
Cysteine (Cys, C)
n = 1 (0.57%)
Valine (Val, V)
n = 21 (12.0%)
Leucine (Leu, L)
n = 17 (9.71%)
Isoleucine (Ile, I)
n = 18 (10.29%)
Methionine (Met, M)
n = 11 (6.29%)
Proline (Pro, P)
n = 3 (1.71%)
Phenylalanine (Phe, F)
n = 13 (7.43%)
Tyrosine (Tyr, Y)
n = 10 (5.71%)
Tryptophan (Trp, W)
n = 5 (2.86%)
Aspartic acid (Asp, D)
n = 4 (2.29%)
Glutamic acid (Glu, E)
n = 9 (5.14%)
Asparagine (Asn, N)
n = 4 (2.29%)
Glutamine (Gln, Q)
n = 2 (1.14%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 3 (1.71%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 1 4 2 0 0 1 11 1 1 6 0 7 8 13 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 1 0 2 1 1 2 10 1 7 8 3 0 0 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 2 3 4 1 0 2 4 0 8 2 2 3 4 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 8 4 0 2 1 1 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 9 50 51
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 26 33 80
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
46 6 40 84
Total protein-coding genes (size: 11403 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 217 (5.71%)
Alanine (Ala, A)
n = 243 (6.4%)
Serine (Ser, S)
n = 279 (7.35%)
Threonine (Thr, T)
n = 305 (8.03%)
Cysteine (Cys, C)
n = 22 (0.58%)
Valine (Val, V)
n = 186 (4.9%)
Leucine (Leu, L)
n = 589 (15.51%)
Isoleucine (Ile, I)
n = 343 (9.03%)
Methionine (Met, M)
n = 257 (6.77%)
Proline (Pro, P)
n = 190 (5.0%)
Phenylalanine (Phe, F)
n = 251 (6.61%)
Tyrosine (Tyr, Y)
n = 130 (3.42%)
Tryptophan (Trp, W)
n = 105 (2.76%)
Aspartic acid (Asp, D)
n = 68 (1.79%)
Glutamic acid (Glu, E)
n = 96 (2.53%)
Asparagine (Asn, N)
n = 167 (4.4%)
Glutamine (Gln, Q)
n = 93 (2.45%)
Histidine (His, H)
n = 93 (2.45%)
Lysine (Lys, K)
n = 94 (2.47%)
Arginine (Arg, R)
n = 63 (1.66%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
229 114 214 82 78 252 28 136 87 6 49 38 83 16 132 119
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
43 4 18 46 87 102 8 32 60 100 25 45 56 86 3 61
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
67 167 10 62 55 98 8 19 37 76 54 9 13 72 95 40
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
53 73 23 27 41 80 14 5 17 38 3 1 0 7 0 96
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
810 879 1223 887
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
464 961 748 1626
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
209 989 1620 981

Failed to understand id: ?term=("Rucervus duvaucelii"[Organism]) AND (refseq[filter] AND mitochondrion[filter])


Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.