Viewing data for Hydropotes inermis


Scientific name Hydropotes inermis
Common name Chinese water deer
Maximum lifespan 13.90 years (Hydropotes inermis@AnAge)

Total mtDNA (size: 16355 bases) GC AT G C A T
Base content (bases) 5904 10451 3725 2179 4990 5461
Base content per 1 kb (bases) 361 639 228 133 305 334
Base content (%) 36.1% 63.9%
Total protein-coding genes (size: 11339 bases) GC AT G C A T
Base content (bases) 4050 7289 2692 1358 3603 3686
Base content per 1 kb (bases) 357 643 237 120 318 325
Base content (%) 35.7% 64.3%
D-loop (size: 926 bases) GC AT G C A T
Base content (bases) 351 575 215 136 303 272
Base content per 1 kb (bases) 379 621 232 147 327 294
Base content (%) 37.9% 62.1%
Total tRNA-coding genes (size: 1508 bases) GC AT G C A T
Base content (bases) 535 973 301 234 434 539
Base content per 1 kb (bases) 355 645 200 155 288 357
Base content (%) 35.5% 64.5%
Total rRNA-coding genes (size: 2524 bases) GC AT G C A T
Base content (bases) 940 1584 500 440 638 946
Base content per 1 kb (bases) 372 628 198 174 253 375
Base content (%) 37.2% 62.8%
12S rRNA gene (size: 957 bases) GC AT G C A T
Base content (bases) 375 582 201 174 229 353
Base content per 1 kb (bases) 392 608 210 182 239 369
Base content (%) 39.2% 60.8%
16S rRNA gene (size: 1567 bases) GC AT G C A T
Base content (bases) 565 1002 299 266 409 593
Base content per 1 kb (bases) 361 639 191 170 261 378
Base content (%) 36.1% 63.9%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 249 432 168 81 221 211
Base content per 1 kb (bases) 366 634 247 119 325 310
Base content (%) 36.6% 63.4%
ATP8 (size: 201 bases) GC AT G C A T
Base content (bases) 59 142 44 15 61 81
Base content per 1 kb (bases) 294 706 219 75 303 403
Base content (%) 29.4% 70.6%
COX1 (size: 1545 bases) GC AT G C A T
Base content (bases) 556 989 313 243 541 448
Base content per 1 kb (bases) 360 640 203 157 350 290
Base content (%) 36.0% 64.0%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 231 453 140 91 211 242
Base content per 1 kb (bases) 338 662 205 133 308 354
Base content (%) 33.8% 66.2%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 324 460 208 116 246 214
Base content per 1 kb (bases) 413 587 265 148 314 273
Base content (%) 41.3% 58.7%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 433 707 284 149 356 351
Base content per 1 kb (bases) 380 620 249 131 312 308
Base content (%) 38.0% 62.0%
ND1 (size: 956 bases) GC AT G C A T
Base content (bases) 342 614 228 114 312 302
Base content per 1 kb (bases) 358 642 238 119 326 316
Base content (%) 35.8% 64.2%
ND2 (size: 1043 bases) GC AT G C A T
Base content (bases) 342 701 249 93 319 382
Base content per 1 kb (bases) 328 672 239 89 306 366
Base content (%) 32.8% 67.2%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 122 224 84 38 112 112
Base content per 1 kb (bases) 353 647 243 110 324 324
Base content (%) 35.3% 64.7%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 496 882 345 151 440 442
Base content per 1 kb (bases) 360 640 250 110 319 321
Base content (%) 36.0% 64.0%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 103 194 62 41 105 89
Base content per 1 kb (bases) 347 653 209 138 354 300
Base content (%) 34.7% 65.3%
ND5 (size: 1821 bases) GC AT G C A T
Base content (bases) 627 1194 433 194 580 614
Base content per 1 kb (bases) 344 656 238 107 319 337
Base content (%) 34.4% 65.6%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 183 345 145 38 123 222
Base content per 1 kb (bases) 347 653 275 72 233 420
Base content (%) 34.7% 65.3%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (5.31%)
Alanine (Ala, A)
n = 16 (7.08%)
Serine (Ser, S)
n = 15 (6.64%)
Threonine (Thr, T)
n = 24 (10.62%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 12 (5.31%)
Leucine (Leu, L)
n = 43 (19.03%)
Isoleucine (Ile, I)
n = 25 (11.06%)
Methionine (Met, M)
n = 12 (5.31%)
Proline (Pro, P)
n = 12 (5.31%)
Phenylalanine (Phe, F)
n = 13 (5.75%)
Tyrosine (Tyr, Y)
n = 2 (0.88%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 10 (4.42%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 6 (2.65%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 4 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 3 10 9 6 11 5 12 8 1 5 1 5 1 11 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 5 6 5 0 1 4 5 2 0 5 7 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 13 1 2 1 6 0 4 2 0 2 0 0 7 3 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 3 0 0 1 4 0 3 0 1 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
44 62 81 40
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 61 36 105
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 45 94 76
ATP8 (size: 201 bases)
Amino acid sequence: MPQLDTSTWLVMILSMFMVLFIIFQLKVSKHNFYFNPEPKSTKMQKQNTPWEVKWTKIYLPLLLPQ*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 4 (6.06%)
Threonine (Thr, T)
n = 5 (7.58%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 4 (6.06%)
Leucine (Leu, L)
n = 9 (13.64%)
Isoleucine (Ile, I)
n = 4 (6.06%)
Methionine (Met, M)
n = 5 (7.58%)
Proline (Pro, P)
n = 6 (9.09%)
Phenylalanine (Phe, F)
n = 5 (7.58%)
Tyrosine (Tyr, Y)
n = 2 (3.03%)
Tryptophan (Trp, W)
n = 3 (4.55%)
Aspartic acid (Asp, D)
n = 1 (1.52%)
Glutamic acid (Glu, E)
n = 2 (3.03%)
Asparagine (Asn, N)
n = 3 (4.55%)
Glutamine (Gln, Q)
n = 5 (7.58%)
Histidine (His, H)
n = 1 (1.52%)
Lysine (Lys, K)
n = 7 (10.61%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 2 4 2 1 1 0 4 4 1 0 1 2 1 4 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 0 0 0 0 0 0 3 1 2 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 2 1 0 1 3 0 0 0 1 1 0 1 1 2 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 0 0 1 7 0 0 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
7 16 24 20
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
3 15 22 27
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 13 35 14
COX1 (size: 1545 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.14%)
Alanine (Ala, A)
n = 39 (7.59%)
Serine (Ser, S)
n = 30 (5.84%)
Threonine (Thr, T)
n = 38 (7.39%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 37 (7.2%)
Leucine (Leu, L)
n = 60 (11.67%)
Isoleucine (Ile, I)
n = 39 (7.59%)
Methionine (Met, M)
n = 33 (6.42%)
Proline (Pro, P)
n = 28 (5.45%)
Phenylalanine (Phe, F)
n = 42 (8.17%)
Tyrosine (Tyr, Y)
n = 19 (3.7%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 15 (2.92%)
Glutamic acid (Glu, E)
n = 10 (1.95%)
Asparagine (Asn, N)
n = 19 (3.7%)
Glutamine (Gln, Q)
n = 6 (1.17%)
Histidine (His, H)
n = 17 (3.31%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
33 6 30 8 7 20 2 23 6 0 17 3 13 4 30 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 12 9 18 0 11 10 21 5 15 5 8 0 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 20 0 10 3 14 0 3 0 15 4 2 0 15 4 10
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 9 1 9 6 8 1 1 1 5 1 0 0 1 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
148 96 141 130
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 132 96 211
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 85 211 200
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 8 (3.52%)
Serine (Ser, S)
n = 21 (9.25%)
Threonine (Thr, T)
n = 18 (7.93%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 14 (6.17%)
Leucine (Leu, L)
n = 34 (14.98%)
Isoleucine (Ile, I)
n = 17 (7.49%)
Methionine (Met, M)
n = 15 (6.61%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 6 (2.64%)
Tyrosine (Tyr, Y)
n = 11 (4.85%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 10 (4.41%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 5 (2.2%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 7 (3.08%)
Lysine (Lys, K)
n = 6 (2.64%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 4 11 3 2 14 3 12 6 0 5 3 6 0 5 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 2 0 2 3 3 0 3 0 4 1 2 1 10 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 11 0 6 2 8 0 1 4 11 0 0 0 2 3 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 13 2 4 6 6 0 0 1 5 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
55 54 66 53
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 55 61 86
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 31 115 72
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 15 (5.77%)
Serine (Ser, S)
n = 19 (7.31%)
Threonine (Thr, T)
n = 23 (8.85%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 15 (5.77%)
Leucine (Leu, L)
n = 32 (12.31%)
Isoleucine (Ile, I)
n = 17 (6.54%)
Methionine (Met, M)
n = 9 (3.46%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 7 (2.69%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 7 6 7 3 11 3 8 6 1 2 6 6 1 11 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 2 4 8 3 0 5 7 5 3 3 3 6 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 10 0 4 1 10 0 3 1 6 5 1 0 4 3 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 8 0 3 0 3 0 1 2 2 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
61 65 63 72
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 65 56 97
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 78 95 76
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.33%)
Alanine (Ala, A)
n = 22 (5.8%)
Serine (Ser, S)
n = 24 (6.33%)
Threonine (Thr, T)
n = 24 (6.33%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 21 (5.54%)
Leucine (Leu, L)
n = 59 (15.57%)
Isoleucine (Ile, I)
n = 39 (10.29%)
Methionine (Met, M)
n = 15 (3.96%)
Proline (Pro, P)
n = 23 (6.07%)
Phenylalanine (Phe, F)
n = 28 (7.39%)
Tyrosine (Tyr, Y)
n = 15 (3.96%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 18 (4.75%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 11 (2.9%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
25 14 10 11 10 19 5 14 6 0 2 9 9 1 15 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 3 2 5 15 0 3 5 15 1 3 4 16 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 15 1 4 5 12 0 0 3 9 6 0 0 11 7 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 6 0 5 6 9 0 0 1 7 0 1 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
84 93 109 94
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 90 76 162
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 101 166 100
ND1 (size: 956 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.79%)
Alanine (Ala, A)
n = 28 (8.83%)
Serine (Ser, S)
n = 23 (7.26%)
Threonine (Thr, T)
n = 18 (5.68%)
Cysteine (Cys, C)
n = 1 (0.32%)
Valine (Val, V)
n = 14 (4.42%)
Leucine (Leu, L)
n = 56 (17.67%)
Isoleucine (Ile, I)
n = 33 (10.41%)
Methionine (Met, M)
n = 17 (5.36%)
Proline (Pro, P)
n = 22 (6.94%)
Phenylalanine (Phe, F)
n = 22 (6.94%)
Tyrosine (Tyr, Y)
n = 11 (3.47%)
Tryptophan (Trp, W)
n = 9 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.95%)
Glutamic acid (Glu, E)
n = 11 (3.47%)
Asparagine (Asn, N)
n = 13 (4.1%)
Glutamine (Gln, Q)
n = 7 (2.21%)
Histidine (His, H)
n = 3 (0.95%)
Lysine (Lys, K)
n = 7 (2.21%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
25 8 15 6 3 28 4 14 7 0 4 0 9 1 13 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 8 4 16 0 3 5 4 0 8 6 7 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 12 1 3 5 11 1 2 1 6 5 0 1 6 7 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 10 1 2 1 6 1 0 1 7 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 81 91 78
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 88 55 142
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 59 155 91
ND2 (size: 1043 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 17 (4.91%)
Serine (Ser, S)
n = 28 (8.09%)
Threonine (Thr, T)
n = 38 (10.98%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 13 (3.76%)
Leucine (Leu, L)
n = 53 (15.32%)
Isoleucine (Ile, I)
n = 34 (9.83%)
Methionine (Met, M)
n = 45 (13.01%)
Proline (Pro, P)
n = 20 (5.78%)
Phenylalanine (Phe, F)
n = 14 (4.05%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 17 (4.91%)
Glutamine (Gln, Q)
n = 10 (2.89%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 12 (3.47%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
25 9 36 6 7 23 1 16 10 0 5 4 4 0 9 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 0 0 3 6 8 0 1 4 8 1 4 4 12 0 12
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 14 1 2 8 16 0 0 2 5 3 1 0 9 8 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 5 0 1 0 11 1 0 0 3 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
50 75 148 74
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 101 58 159
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 73 175 85
ND3 (size: 1043 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 17 (4.91%)
Serine (Ser, S)
n = 28 (8.09%)
Threonine (Thr, T)
n = 38 (10.98%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 13 (3.76%)
Leucine (Leu, L)
n = 53 (15.32%)
Isoleucine (Ile, I)
n = 34 (9.83%)
Methionine (Met, M)
n = 45 (13.01%)
Proline (Pro, P)
n = 20 (5.78%)
Phenylalanine (Phe, F)
n = 14 (4.05%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 17 (4.91%)
Glutamine (Gln, Q)
n = 10 (2.89%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 12 (3.47%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
25 9 36 6 7 23 1 16 10 0 5 4 4 0 9 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 0 0 3 6 8 0 1 4 8 1 4 4 12 0 12
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 14 1 2 8 16 0 0 2 5 3 1 0 9 8 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 5 0 1 0 11 1 0 0 3 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
50 75 148 74
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 101 58 159
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 73 175 85
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.93%)
Alanine (Ala, A)
n = 26 (5.68%)
Serine (Ser, S)
n = 41 (8.95%)
Threonine (Thr, T)
n = 36 (7.86%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 17 (3.71%)
Leucine (Leu, L)
n = 93 (20.31%)
Isoleucine (Ile, I)
n = 37 (8.08%)
Methionine (Met, M)
n = 37 (8.08%)
Proline (Pro, P)
n = 20 (4.37%)
Phenylalanine (Phe, F)
n = 22 (4.8%)
Tyrosine (Tyr, Y)
n = 17 (3.71%)
Tryptophan (Trp, W)
n = 13 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 10 (2.18%)
Asparagine (Asn, N)
n = 24 (5.24%)
Glutamine (Gln, Q)
n = 10 (2.18%)
Histidine (His, H)
n = 11 (2.4%)
Lysine (Lys, K)
n = 11 (2.4%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
25 12 33 13 13 33 5 23 9 1 4 5 8 0 9 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 3 0 7 8 10 1 2 7 9 0 11 3 6 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 19 1 5 12 12 1 5 6 12 5 0 6 11 13 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 9 1 0 3 10 1 0 3 6 1 0 0 0 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 115 156 114
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
55 112 86 206
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 118 200 119
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 8 (8.16%)
Serine (Ser, S)
n = 9 (9.18%)
Threonine (Thr, T)
n = 7 (7.14%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 9 (9.18%)
Leucine (Leu, L)
n = 22 (22.45%)
Isoleucine (Ile, I)
n = 4 (4.08%)
Methionine (Met, M)
n = 10 (10.2%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 4 (4.08%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 5 (5.1%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 0 9 2 2 7 2 7 2 0 3 0 5 1 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 2 2 2 4 0 1 1 2 0 0 1 0 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 3 1 2 3 3 0 1 0 4 0 0 2 2 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 1 1 1 0 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
24 19 27 29
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 24 17 49
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 19 45 27
ND5 (size: 1821 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (4.46%)
Alanine (Ala, A)
n = 39 (6.44%)
Serine (Ser, S)
n = 48 (7.92%)
Threonine (Thr, T)
n = 52 (8.58%)
Cysteine (Cys, C)
n = 5 (0.83%)
Valine (Val, V)
n = 17 (2.81%)
Leucine (Leu, L)
n = 83 (13.7%)
Isoleucine (Ile, I)
n = 65 (10.73%)
Methionine (Met, M)
n = 43 (7.1%)
Proline (Pro, P)
n = 26 (4.29%)
Phenylalanine (Phe, F)
n = 50 (8.25%)
Tyrosine (Tyr, Y)
n = 18 (2.97%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 11 (1.82%)
Glutamic acid (Glu, E)
n = 12 (1.98%)
Asparagine (Asn, N)
n = 38 (6.27%)
Glutamine (Gln, Q)
n = 19 (3.14%)
Histidine (His, H)
n = 11 (1.82%)
Lysine (Lys, K)
n = 22 (3.63%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
46 19 37 11 13 33 2 24 16 3 6 3 8 0 35 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 3 2 7 11 20 1 4 10 11 2 5 9 11 1 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 28 2 6 12 16 1 4 9 13 5 2 0 18 20 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 9 3 5 6 22 0 1 4 3 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
106 123 233 145
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
65 152 132 258
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
23 158 249 177
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (14.86%)
Alanine (Ala, A)
n = 6 (3.43%)
Serine (Ser, S)
n = 11 (6.29%)
Threonine (Thr, T)
n = 10 (5.71%)
Cysteine (Cys, C)
n = 1 (0.57%)
Valine (Val, V)
n = 24 (13.71%)
Leucine (Leu, L)
n = 16 (9.14%)
Isoleucine (Ile, I)
n = 17 (9.71%)
Methionine (Met, M)
n = 11 (6.29%)
Proline (Pro, P)
n = 3 (1.71%)
Phenylalanine (Phe, F)
n = 13 (7.43%)
Tyrosine (Tyr, Y)
n = 10 (5.71%)
Tryptophan (Trp, W)
n = 4 (2.29%)
Aspartic acid (Asp, D)
n = 4 (2.29%)
Glutamic acid (Glu, E)
n = 9 (5.14%)
Asparagine (Asn, N)
n = 4 (2.29%)
Glutamine (Gln, Q)
n = 2 (1.14%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 3 (1.71%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 1 5 1 0 0 0 13 0 2 9 0 7 8 13 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 0 4 0 1 1 13 2 4 7 3 0 0 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 3 3 5 0 1 1 4 0 8 2 2 2 4 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 3 6 4 0 1 2 1 0 0 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 7 49 51
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 26 33 81
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
40 5 41 90
Total protein-coding genes (size: 11404 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 215 (5.66%)
Alanine (Ala, A)
n = 235 (6.19%)
Serine (Ser, S)
n = 280 (7.37%)
Threonine (Thr, T)
n = 301 (7.93%)
Cysteine (Cys, C)
n = 23 (0.61%)
Valine (Val, V)
n = 200 (5.27%)
Leucine (Leu, L)
n = 587 (15.46%)
Isoleucine (Ile, I)
n = 337 (8.87%)
Methionine (Met, M)
n = 258 (6.79%)
Proline (Pro, P)
n = 192 (5.06%)
Phenylalanine (Phe, F)
n = 252 (6.64%)
Tyrosine (Tyr, Y)
n = 132 (3.48%)
Tryptophan (Trp, W)
n = 104 (2.74%)
Aspartic acid (Asp, D)
n = 67 (1.76%)
Glutamic acid (Glu, E)
n = 99 (2.61%)
Asparagine (Asn, N)
n = 167 (4.4%)
Glutamine (Gln, Q)
n = 92 (2.42%)
Histidine (His, H)
n = 91 (2.4%)
Lysine (Lys, K)
n = 96 (2.53%)
Arginine (Arg, R)
n = 63 (1.66%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
250 87 212 84 69 212 32 178 83 9 64 35 83 18 161 91
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
46 12 11 60 66 106 3 47 55 91 22 59 43 88 2 70
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
64 155 12 50 53 116 4 27 30 93 39 8 12 90 77 46
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
45 84 15 36 31 89 7 7 14 40 2 1 0 7 0 96
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
816 835 1217 931
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
463 951 751 1634
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
192 810 1641 1156

Failed to understand id: ?term=("Hydropotes inermis"[Organism]) AND (refseq[filter] AND mitochondrion[filter])


Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.