Viewing data for Ovis ammon


Scientific name Ovis ammon
Common name Argali
Maximum lifespan 16.80 years (Ovis ammon@AnAge)

Total mtDNA (size: 16613 bases) GC AT G C A T
Base content (bases) 6458 10155 4285 2173 4562 5593
Base content per 1 kb (bases) 389 611 258 131 275 337
Base content (%) 38.9% 61.1%
Total protein-coding genes (size: 11336 bases) GC AT G C A T
Base content (bases) 4467 6869 3142 1325 3164 3705
Base content per 1 kb (bases) 394 606 277 117 279 327
Base content (%) 39.4% 60.6%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1510 bases) GC AT G C A T
Base content (bases) 537 973 311 226 438 535
Base content per 1 kb (bases) 356 644 206 150 290 354
Base content (%) 35.6% 64.4%
Total rRNA-coding genes (size: 2533 bases) GC AT G C A T
Base content (bases) 993 1540 551 442 598 942
Base content per 1 kb (bases) 392 608 218 174 236 372
Base content (%) 39.2% 60.8%
12S rRNA gene (size: 959 bases) GC AT G C A T
Base content (bases) 399 560 225 174 210 350
Base content per 1 kb (bases) 416 584 235 181 219 365
Base content (%) 41.6% 58.4%
16S rRNA gene (size: 1574 bases) GC AT G C A T
Base content (bases) 594 980 326 268 388 592
Base content per 1 kb (bases) 377 623 207 170 247 376
Base content (%) 37.7% 62.3%

ATP6 (size: 679 bases) GC AT G C A T
Base content (bases) 275 404 197 78 190 214
Base content per 1 kb (bases) 405 595 290 115 280 315
Base content (%) 40.5% 59.5%
ATP8 (size: 201 bases) GC AT G C A T
Base content (bases) 62 139 50 12 55 84
Base content per 1 kb (bases) 308 692 249 60 274 418
Base content (%) 30.8% 69.2%
COX1 (size: 1545 bases) GC AT G C A T
Base content (bases) 626 919 378 248 468 451
Base content per 1 kb (bases) 405 595 245 161 303 292
Base content (%) 40.5% 59.5%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 258 426 167 91 185 241
Base content per 1 kb (bases) 377 623 244 133 270 352
Base content (%) 37.7% 62.3%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 353 431 233 120 226 205
Base content per 1 kb (bases) 450 550 297 153 288 261
Base content (%) 45.0% 55.0%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 474 666 332 142 302 364
Base content per 1 kb (bases) 416 584 291 125 265 319
Base content (%) 41.6% 58.4%
ND1 (size: 955 bases) GC AT G C A T
Base content (bases) 380 575 275 105 269 306
Base content per 1 kb (bases) 398 602 288 110 282 320
Base content (%) 39.8% 60.2%
ND2 (size: 1042 bases) GC AT G C A T
Base content (bases) 376 666 288 88 281 385
Base content per 1 kb (bases) 361 639 276 84 270 369
Base content (%) 36.1% 63.9%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 143 203 100 43 99 104
Base content per 1 kb (bases) 413 587 289 124 286 301
Base content (%) 41.3% 58.7%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 533 845 385 148 405 440
Base content per 1 kb (bases) 387 613 279 107 294 319
Base content (%) 38.7% 61.3%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 114 183 78 36 92 91
Base content per 1 kb (bases) 384 616 263 121 310 306
Base content (%) 38.4% 61.6%
ND5 (size: 1821 bases) GC AT G C A T
Base content (bases) 704 1117 521 183 501 616
Base content per 1 kb (bases) 387 613 286 100 275 338
Base content (%) 38.7% 61.3%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 189 339 152 37 113 226
Base content per 1 kb (bases) 358 642 288 70 214 428
Base content (%) 35.8% 64.2%

ATP6 (size: 679 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.89%)
Alanine (Ala, A)
n = 16 (7.11%)
Serine (Ser, S)
n = 15 (6.67%)
Threonine (Thr, T)
n = 24 (10.67%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 11 (4.89%)
Leucine (Leu, L)
n = 45 (20.0%)
Isoleucine (Ile, I)
n = 25 (11.11%)
Methionine (Met, M)
n = 12 (5.33%)
Proline (Pro, P)
n = 12 (5.33%)
Phenylalanine (Phe, F)
n = 12 (5.33%)
Tyrosine (Tyr, Y)
n = 2 (0.89%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 11 (4.89%)
Glutamine (Gln, Q)
n = 9 (4.0%)
Histidine (His, H)
n = 6 (2.67%)
Lysine (Lys, K)
n = 4 (1.78%)
Arginine (Arg, R)
n = 4 (1.78%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 8 8 4 10 19 2 9 8 1 3 1 6 1 6 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 4 7 5 0 0 4 6 1 3 4 5 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 14 1 1 3 5 0 0 6 1 1 0 1 3 8 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 2 1 1 0 4 0 0 2 2 0 0 0 0 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
42 66 82 36
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
24 61 36 105
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 70 96 48
ATP8 (size: 201 bases)
Amino acid sequence: MPQLDTSTWLTMILSMFLALFIIFQLKISKHNFYHNPELMMTKAPKQNTPWETKWTKIYLPLSLPL*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 2 (3.03%)
Serine (Ser, S)
n = 4 (6.06%)
Threonine (Thr, T)
n = 7 (10.61%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 11 (16.67%)
Isoleucine (Ile, I)
n = 5 (7.58%)
Methionine (Met, M)
n = 5 (7.58%)
Proline (Pro, P)
n = 6 (9.09%)
Phenylalanine (Phe, F)
n = 4 (6.06%)
Tyrosine (Tyr, Y)
n = 2 (3.03%)
Tryptophan (Trp, W)
n = 3 (4.55%)
Aspartic acid (Asp, D)
n = 1 (1.52%)
Glutamic acid (Glu, E)
n = 2 (3.03%)
Asparagine (Asn, N)
n = 3 (4.55%)
Glutamine (Gln, Q)
n = 3 (4.55%)
Histidine (His, H)
n = 2 (3.03%)
Lysine (Lys, K)
n = 6 (9.09%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 2 4 2 1 4 0 3 3 0 0 0 0 0 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 1 1 0 0 0 0 0 1 2 3 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 4 2 0 0 4 0 0 0 1 1 0 1 0 3 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 1 0 6 0 0 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
5 18 26 18
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
3 19 20 25
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 13 38 12
COX1 (size: 1545 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.14%)
Alanine (Ala, A)
n = 40 (7.78%)
Serine (Ser, S)
n = 30 (5.84%)
Threonine (Thr, T)
n = 38 (7.39%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 36 (7.0%)
Leucine (Leu, L)
n = 60 (11.67%)
Isoleucine (Ile, I)
n = 39 (7.59%)
Methionine (Met, M)
n = 33 (6.42%)
Proline (Pro, P)
n = 28 (5.45%)
Phenylalanine (Phe, F)
n = 42 (8.17%)
Tyrosine (Tyr, Y)
n = 19 (3.7%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 16 (3.11%)
Glutamic acid (Glu, E)
n = 9 (1.75%)
Asparagine (Asn, N)
n = 19 (3.7%)
Glutamine (Gln, Q)
n = 6 (1.17%)
Histidine (His, H)
n = 17 (3.31%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
24 15 28 11 5 30 3 11 5 1 3 8 23 2 25 17
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 0 8 15 17 0 8 9 25 5 13 6 8 1 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 16 3 7 7 12 1 1 2 9 10 0 0 6 13 9
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 8 1 6 10 9 0 0 2 4 2 0 0 1 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
148 108 141 118
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 133 96 210
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 137 214 140
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 8 (3.52%)
Serine (Ser, S)
n = 21 (9.25%)
Threonine (Thr, T)
n = 18 (7.93%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 11 (4.85%)
Leucine (Leu, L)
n = 33 (14.54%)
Isoleucine (Ile, I)
n = 19 (8.37%)
Methionine (Met, M)
n = 17 (7.49%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 7 (3.08%)
Tyrosine (Tyr, Y)
n = 10 (4.41%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 10 (4.41%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 5 (2.2%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 7 (3.08%)
Lysine (Lys, K)
n = 6 (2.64%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 14 11 4 1 19 2 6 4 2 3 3 5 0 4 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 2 1 1 5 1 2 3 3 0 1 2 10 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 11 0 4 4 8 0 2 3 7 3 0 1 3 2 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 15 0 6 4 5 1 3 0 3 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
52 58 70 48
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 55 60 87
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 54 111 50
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 17 (6.54%)
Serine (Ser, S)
n = 20 (7.69%)
Threonine (Thr, T)
n = 22 (8.46%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 16 (6.15%)
Leucine (Leu, L)
n = 32 (12.31%)
Isoleucine (Ile, I)
n = 14 (5.38%)
Methionine (Met, M)
n = 10 (3.85%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 12 (4.62%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 6 (2.31%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 7 7 7 7 13 2 3 5 2 2 5 8 1 10 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 2 7 6 4 0 3 9 6 2 0 7 5 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 11 0 4 4 7 0 1 4 4 8 0 0 2 4 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 7 1 2 1 1 1 2 1 2 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
64 70 59 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 66 55 96
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 97 91 61
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.33%)
Alanine (Ala, A)
n = 23 (6.07%)
Serine (Ser, S)
n = 20 (5.28%)
Threonine (Thr, T)
n = 28 (7.39%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 18 (4.75%)
Leucine (Leu, L)
n = 53 (13.98%)
Isoleucine (Ile, I)
n = 43 (11.35%)
Methionine (Met, M)
n = 19 (5.01%)
Proline (Pro, P)
n = 24 (6.33%)
Phenylalanine (Phe, F)
n = 26 (6.86%)
Tyrosine (Tyr, Y)
n = 15 (3.96%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 18 (4.75%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 21 17 4 16 27 1 5 6 0 2 7 9 0 8 18
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 3 1 8 14 0 1 8 13 2 6 5 13 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 17 0 3 2 11 1 1 2 7 8 1 0 2 16 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 6 0 2 9 8 1 0 0 8 0 1 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
82 98 121 79
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 92 77 159
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 142 166 64
ND1 (size: 955 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.79%)
Alanine (Ala, A)
n = 28 (8.83%)
Serine (Ser, S)
n = 21 (6.62%)
Threonine (Thr, T)
n = 22 (6.94%)
Cysteine (Cys, C)
n = 1 (0.32%)
Valine (Val, V)
n = 15 (4.73%)
Leucine (Leu, L)
n = 55 (17.35%)
Isoleucine (Ile, I)
n = 30 (9.46%)
Methionine (Met, M)
n = 18 (5.68%)
Proline (Pro, P)
n = 22 (6.94%)
Phenylalanine (Phe, F)
n = 21 (6.62%)
Tyrosine (Tyr, Y)
n = 12 (3.79%)
Tryptophan (Trp, W)
n = 9 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.95%)
Glutamic acid (Glu, E)
n = 11 (3.47%)
Asparagine (Asn, N)
n = 13 (4.1%)
Glutamine (Gln, Q)
n = 7 (2.21%)
Histidine (His, H)
n = 3 (0.95%)
Lysine (Lys, K)
n = 7 (2.21%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 16 17 3 12 32 0 8 7 0 4 2 9 0 10 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 6 10 11 1 2 3 7 0 1 13 8 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 15 0 4 3 11 1 0 2 8 4 0 0 4 9 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 10 1 0 3 7 0 1 0 7 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 87 92 70
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 91 56 139
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 97 158 59
ND2 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 18 (5.2%)
Serine (Ser, S)
n = 25 (7.23%)
Threonine (Thr, T)
n = 42 (12.14%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (2.6%)
Leucine (Leu, L)
n = 57 (16.47%)
Isoleucine (Ile, I)
n = 41 (11.85%)
Methionine (Met, M)
n = 38 (10.98%)
Proline (Pro, P)
n = 20 (5.78%)
Phenylalanine (Phe, F)
n = 12 (3.47%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 16 (4.62%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 13 (3.76%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
28 13 35 7 10 28 3 8 9 0 2 3 4 0 7 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 2 9 7 0 1 5 8 0 0 8 11 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 21 2 3 6 14 0 0 2 4 4 0 1 5 11 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 5 0 0 1 12 1 0 0 4 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
47 86 152 62
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 103 57 157
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 99 176 61
ND3 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 18 (5.2%)
Serine (Ser, S)
n = 25 (7.23%)
Threonine (Thr, T)
n = 42 (12.14%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (2.6%)
Leucine (Leu, L)
n = 57 (16.47%)
Isoleucine (Ile, I)
n = 41 (11.85%)
Methionine (Met, M)
n = 38 (10.98%)
Proline (Pro, P)
n = 20 (5.78%)
Phenylalanine (Phe, F)
n = 12 (3.47%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 16 (4.62%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 13 (3.76%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
28 13 35 7 10 28 3 8 9 0 2 3 4 0 7 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 2 9 7 0 1 5 8 0 0 8 11 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 21 2 3 6 14 0 0 2 4 4 0 1 5 11 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 5 0 0 1 12 1 0 0 4 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
47 86 152 62
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 103 57 157
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 99 176 61
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.93%)
Alanine (Ala, A)
n = 29 (6.33%)
Serine (Ser, S)
n = 38 (8.3%)
Threonine (Thr, T)
n = 35 (7.64%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 13 (2.84%)
Leucine (Leu, L)
n = 95 (20.74%)
Isoleucine (Ile, I)
n = 41 (8.95%)
Methionine (Met, M)
n = 37 (8.08%)
Proline (Pro, P)
n = 21 (4.59%)
Phenylalanine (Phe, F)
n = 21 (4.59%)
Tyrosine (Tyr, Y)
n = 15 (3.28%)
Tryptophan (Trp, W)
n = 13 (2.84%)
Aspartic acid (Asp, D)
n = 4 (0.87%)
Glutamic acid (Glu, E)
n = 8 (1.75%)
Asparagine (Asn, N)
n = 24 (5.24%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 12 (2.62%)
Lysine (Lys, K)
n = 11 (2.4%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 20 29 19 15 45 5 10 11 0 4 4 5 0 12 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 0 3 7 9 13 0 4 5 8 1 1 10 9 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 19 2 5 10 13 0 1 9 9 6 2 1 11 13 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 8 0 1 3 10 1 0 3 6 1 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
72 138 158 91
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
54 113 85 207
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 134 197 106
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 7 (7.14%)
Serine (Ser, S)
n = 10 (10.2%)
Threonine (Thr, T)
n = 5 (5.1%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 6 (6.12%)
Leucine (Leu, L)
n = 23 (23.47%)
Isoleucine (Ile, I)
n = 5 (5.1%)
Methionine (Met, M)
n = 13 (13.27%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 4 (4.08%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 5 (5.1%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 1 9 2 3 13 1 4 2 0 1 0 3 2 1 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 3 1 2 4 0 0 2 2 0 0 1 0 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 2 0 1 6 2 0 1 0 3 1 0 0 1 4 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 0 1 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
20 25 29 25
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 22 17 51
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 31 45 16
ND5 (size: 1821 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (4.62%)
Alanine (Ala, A)
n = 41 (6.77%)
Serine (Ser, S)
n = 46 (7.59%)
Threonine (Thr, T)
n = 60 (9.9%)
Cysteine (Cys, C)
n = 5 (0.83%)
Valine (Val, V)
n = 12 (1.98%)
Leucine (Leu, L)
n = 89 (14.69%)
Isoleucine (Ile, I)
n = 65 (10.73%)
Methionine (Met, M)
n = 37 (6.11%)
Proline (Pro, P)
n = 26 (4.29%)
Phenylalanine (Phe, F)
n = 47 (7.76%)
Tyrosine (Tyr, Y)
n = 17 (2.81%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 11 (1.82%)
Glutamic acid (Glu, E)
n = 11 (1.82%)
Asparagine (Asn, N)
n = 37 (6.11%)
Glutamine (Gln, Q)
n = 18 (2.97%)
Histidine (His, H)
n = 14 (2.31%)
Lysine (Lys, K)
n = 22 (3.63%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
32 33 34 8 19 47 2 13 18 0 4 3 5 0 23 24
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 4 4 16 21 0 0 11 15 2 1 13 11 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
23 31 2 7 13 15 0 2 9 12 5 0 0 16 21 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 8 3 3 8 19 3 1 4 3 0 0 0 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
103 142 232 130
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
64 162 131 250
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 217 253 121
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (14.86%)
Alanine (Ala, A)
n = 6 (3.43%)
Serine (Ser, S)
n = 11 (6.29%)
Threonine (Thr, T)
n = 9 (5.14%)
Cysteine (Cys, C)
n = 1 (0.57%)
Valine (Val, V)
n = 25 (14.29%)
Leucine (Leu, L)
n = 16 (9.14%)
Isoleucine (Ile, I)
n = 14 (8.0%)
Methionine (Met, M)
n = 12 (6.86%)
Proline (Pro, P)
n = 3 (1.71%)
Phenylalanine (Phe, F)
n = 15 (8.57%)
Tyrosine (Tyr, Y)
n = 10 (5.71%)
Tryptophan (Trp, W)
n = 4 (2.29%)
Aspartic acid (Asp, D)
n = 4 (2.29%)
Glutamic acid (Glu, E)
n = 8 (4.57%)
Asparagine (Asn, N)
n = 4 (2.29%)
Glutamine (Gln, Q)
n = 1 (0.57%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 5 (2.86%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 1 5 0 0 0 0 11 0 1 14 0 3 8 14 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 1 0 5 0 1 0 11 1 2 12 3 0 0 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 2 2 5 0 2 0 2 2 8 2 3 5 4 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 3 5 4 0 1 4 1 0 0 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 5 48 54
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 25 33 82
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
47 7 32 90
Total protein-coding genes (size: 11400 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 215 (5.66%)
Alanine (Ala, A)
n = 244 (6.43%)
Serine (Ser, S)
n = 267 (7.03%)
Threonine (Thr, T)
n = 322 (8.48%)
Cysteine (Cys, C)
n = 23 (0.61%)
Valine (Val, V)
n = 176 (4.64%)
Leucine (Leu, L)
n = 595 (15.67%)
Isoleucine (Ile, I)
n = 347 (9.14%)
Methionine (Met, M)
n = 257 (6.77%)
Proline (Pro, P)
n = 194 (5.11%)
Phenylalanine (Phe, F)
n = 244 (6.43%)
Tyrosine (Tyr, Y)
n = 129 (3.4%)
Tryptophan (Trp, W)
n = 104 (2.74%)
Aspartic acid (Asp, D)
n = 68 (1.79%)
Glutamic acid (Glu, E)
n = 94 (2.48%)
Asparagine (Asn, N)
n = 166 (4.37%)
Glutamine (Gln, Q)
n = 88 (2.32%)
Histidine (His, H)
n = 97 (2.55%)
Lysine (Lys, K)
n = 97 (2.55%)
Arginine (Arg, R)
n = 64 (1.69%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
193 154 209 74 108 287 23 93 81 7 42 36 83 15 127 117
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
48 5 18 48 89 105 2 32 60 97 26 30 74 86 4 44
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
95 168 15 46 58 106 3 11 43 74 55 8 10 58 108 33
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
64 82 12 27 41 85 12 8 13 40 3 1 0 6 0 96
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
797 935 1244 822
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
461 973 745 1619
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
188 1133 1625 852

Failed to understand id: ?term=("Ovis ammon"[Organism]) AND (refseq[filter] AND mitochondrion[filter])


Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.