Viewing data for Gallus gallus


Scientific name Gallus gallus
Common name Red junglefowl (chicken)
Maximum lifespan 30.00 years (Gallus gallus@AnAge)

Total mtDNA (size: 16775 bases) GC AT G C A T
Base content (bases) 7710 9065 5444 2266 3990 5075
Base content per 1 kb (bases) 460 540 325 135 238 303
Base content (%) 46.0% 54.0%
Total protein-coding genes (size: 11372 bases) GC AT G C A T
Base content (bases) 5339 6033 3975 1364 2657 3376
Base content per 1 kb (bases) 469 531 350 120 234 297
Base content (%) 46.9% 53.1%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1601 bases) GC AT G C A T
Base content (bases) 687 914 413 274 394 520
Base content per 1 kb (bases) 429 571 258 171 246 325
Base content (%) 42.9% 57.1%
Total rRNA-coding genes (size: 2597 bases) GC AT G C A T
Base content (bases) 1211 1386 736 475 530 856
Base content per 1 kb (bases) 466 534 283 183 204 330
Base content (%) 46.6% 53.4%
12S rRNA gene (size: 976 bases) GC AT G C A T
Base content (bases) 460 516 282 178 200 316
Base content per 1 kb (bases) 471 529 289 182 205 324
Base content (%) 47.1% 52.9%
16S rRNA gene (size: 1621 bases) GC AT G C A T
Base content (bases) 751 870 454 297 330 540
Base content per 1 kb (bases) 463 537 280 183 204 333
Base content (%) 46.3% 53.7%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 335 349 264 71 154 195
Base content per 1 kb (bases) 490 510 386 104 225 285
Base content (%) 49.0% 51.0%
ATP8 (size: 165 bases) GC AT G C A T
Base content (bases) 68 97 60 8 40 57
Base content per 1 kb (bases) 412 588 364 48 242 345
Base content (%) 41.2% 58.8%
COX1 (size: 1548 bases) GC AT G C A T
Base content (bases) 730 818 483 247 396 422
Base content per 1 kb (bases) 472 528 312 160 256 273
Base content (%) 47.2% 52.8%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 327 357 228 99 156 201
Base content per 1 kb (bases) 478 522 333 145 228 294
Base content (%) 47.8% 52.2%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 387 397 262 125 179 218
Base content per 1 kb (bases) 494 506 334 159 228 278
Base content (%) 49.4% 50.6%
CYTB (size: 1143 bases) GC AT G C A T
Base content (bases) 553 590 415 138 276 314
Base content per 1 kb (bases) 484 516 363 121 241 275
Base content (%) 48.4% 51.6%
ND1 (size: 975 bases) GC AT G C A T
Base content (bases) 463 512 339 124 247 265
Base content per 1 kb (bases) 475 525 348 127 253 272
Base content (%) 47.5% 52.5%
ND2 (size: 1041 bases) GC AT G C A T
Base content (bases) 463 578 373 90 239 339
Base content per 1 kb (bases) 445 555 358 86 230 326
Base content (%) 44.5% 55.5%
ND3 (size: 351 bases) GC AT G C A T
Base content (bases) 158 193 112 46 95 98
Base content per 1 kb (bases) 450 550 319 131 271 279
Base content (%) 45.0% 55.0%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 638 740 498 140 327 413
Base content per 1 kb (bases) 463 537 361 102 237 300
Base content (%) 46.3% 53.7%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 140 157 103 37 74 83
Base content per 1 kb (bases) 471 529 347 125 249 279
Base content (%) 47.1% 52.9%
ND5 (size: 1818 bases) GC AT G C A T
Base content (bases) 830 988 638 192 425 563
Base content per 1 kb (bases) 457 543 351 106 234 310
Base content (%) 45.7% 54.3%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 252 270 203 49 53 217
Base content per 1 kb (bases) 483 517 389 94 102 416
Base content (%) 48.3% 51.7%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.96%)
Alanine (Ala, A)
n = 18 (7.93%)
Serine (Ser, S)
n = 16 (7.05%)
Threonine (Thr, T)
n = 21 (9.25%)
Cysteine (Cys, C)
n = 1 (0.44%)
Valine (Val, V)
n = 5 (2.2%)
Leucine (Leu, L)
n = 62 (27.31%)
Isoleucine (Ile, I)
n = 19 (8.37%)
Methionine (Met, M)
n = 9 (3.96%)
Proline (Pro, P)
n = 18 (7.93%)
Phenylalanine (Phe, F)
n = 7 (3.08%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 10 (4.41%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 4 (1.76%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 15 6 7 18 29 3 5 8 0 0 2 2 1 0 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 1 12 5 0 2 3 4 0 2 5 11 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 7 1 1 5 6 0 0 4 0 3 1 0 1 9 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 4 0 0 1 2 1 0 2 2 1 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
37 92 66 33
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
23 69 34 102
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 103 95 19
ATP8 (size: 165 bases)
Amino acid sequence: MPQLNPNPWFSIMLLTWFTFSLLIQPKLLSFTLTNNPANKITTTKPTPWTWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 1 (1.85%)
Serine (Ser, S)
n = 3 (5.56%)
Threonine (Thr, T)
n = 10 (18.52%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 8 (14.81%)
Isoleucine (Ile, I)
n = 3 (5.56%)
Methionine (Met, M)
n = 2 (3.7%)
Proline (Pro, P)
n = 8 (14.81%)
Phenylalanine (Phe, F)
n = 4 (7.41%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.26%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 5 (9.26%)
Glutamine (Gln, Q)
n = 2 (3.7%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 3 (5.56%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 2 1 3 1 2 1 1 2 0 0 0 0 0 0 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 1 0 0 0 0 0 1 4 3 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 3 0 1 1 1 0 0 0 0 0 0 0 0 5 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 0 0 3 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
1 17 23 14
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 22 11 17
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 21 23 9
COX1 (size: 1548 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 46 (8.93%)
Alanine (Ala, A)
n = 46 (8.93%)
Serine (Ser, S)
n = 26 (5.05%)
Threonine (Thr, T)
n = 40 (7.77%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 33 (6.41%)
Leucine (Leu, L)
n = 62 (12.04%)
Isoleucine (Ile, I)
n = 41 (7.96%)
Methionine (Met, M)
n = 25 (4.85%)
Proline (Pro, P)
n = 31 (6.02%)
Phenylalanine (Phe, F)
n = 43 (8.35%)
Tyrosine (Tyr, Y)
n = 18 (3.5%)
Tryptophan (Trp, W)
n = 17 (3.3%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 15 (2.91%)
Glutamine (Gln, Q)
n = 9 (1.75%)
Histidine (His, H)
n = 19 (3.69%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 9 (1.75%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 26 21 10 14 27 4 7 8 1 6 12 13 2 11 32
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 7 24 14 1 6 14 23 3 3 16 12 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 15 1 1 8 14 0 0 3 3 15 2 0 3 12 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 10 0 3 12 8 1 0 3 6 0 0 1 0 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
150 123 134 109
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 140 95 204
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 220 193 83
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 15 (6.61%)
Serine (Ser, S)
n = 19 (8.37%)
Threonine (Thr, T)
n = 15 (6.61%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 16 (7.05%)
Leucine (Leu, L)
n = 32 (14.1%)
Isoleucine (Ile, I)
n = 17 (7.49%)
Methionine (Met, M)
n = 10 (4.41%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 8 (3.52%)
Tyrosine (Tyr, Y)
n = 8 (3.52%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 14 (6.17%)
Glutamic acid (Glu, E)
n = 14 (6.17%)
Asparagine (Asn, N)
n = 4 (1.76%)
Glutamine (Gln, Q)
n = 7 (3.08%)
Histidine (His, H)
n = 9 (3.96%)
Lysine (Lys, K)
n = 5 (2.2%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 12 9 4 10 14 3 1 7 0 2 5 8 1 4 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 3 3 9 3 0 0 2 5 1 2 9 2 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 4 0 2 7 8 0 0 2 1 7 0 0 1 3 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 12 2 3 11 4 1 0 2 3 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 65 53 43
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
23 60 62 83
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 103 86 30
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.31%)
Alanine (Ala, A)
n = 22 (8.46%)
Serine (Ser, S)
n = 20 (7.69%)
Threonine (Thr, T)
n = 22 (8.46%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 14 (5.38%)
Leucine (Leu, L)
n = 33 (12.69%)
Isoleucine (Ile, I)
n = 14 (5.38%)
Methionine (Met, M)
n = 10 (3.85%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 9 (3.46%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 4 (1.54%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 4 (1.54%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 12 8 3 8 18 3 1 6 1 3 7 4 0 2 22
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 3 9 10 0 0 7 10 2 0 4 8 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 12 0 3 5 5 1 0 6 1 8 3 0 1 3 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 6 2 0 4 3 1 0 0 5 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 73 60 61
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 70 53 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 119 105 22
CYTB (size: 1143 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.32%)
Alanine (Ala, A)
n = 27 (7.11%)
Serine (Ser, S)
n = 27 (7.11%)
Threonine (Thr, T)
n = 28 (7.37%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 14 (3.68%)
Leucine (Leu, L)
n = 63 (16.58%)
Isoleucine (Ile, I)
n = 33 (8.68%)
Methionine (Met, M)
n = 10 (2.63%)
Proline (Pro, P)
n = 25 (6.58%)
Phenylalanine (Phe, F)
n = 29 (7.63%)
Tyrosine (Tyr, Y)
n = 14 (3.68%)
Tryptophan (Trp, W)
n = 11 (2.89%)
Aspartic acid (Asp, D)
n = 7 (1.84%)
Glutamic acid (Glu, E)
n = 7 (1.84%)
Asparagine (Asn, N)
n = 20 (5.26%)
Glutamine (Gln, Q)
n = 7 (1.84%)
Histidine (His, H)
n = 13 (3.42%)
Lysine (Lys, K)
n = 10 (2.63%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 25 7 7 24 28 1 3 7 0 2 3 8 1 5 24
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 2 2 15 10 0 2 12 8 2 0 11 14 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 9 0 4 14 8 0 0 1 3 11 1 0 2 18 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 6 1 0 7 9 1 0 1 5 2 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
79 113 102 87
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
47 106 79 149
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 196 133 40
ND1 (size: 975 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.7%)
Alanine (Ala, A)
n = 29 (8.95%)
Serine (Ser, S)
n = 26 (8.02%)
Threonine (Thr, T)
n = 25 (7.72%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 12 (3.7%)
Leucine (Leu, L)
n = 66 (20.37%)
Isoleucine (Ile, I)
n = 26 (8.02%)
Methionine (Met, M)
n = 12 (3.7%)
Proline (Pro, P)
n = 26 (8.02%)
Phenylalanine (Phe, F)
n = 19 (5.86%)
Tyrosine (Tyr, Y)
n = 13 (4.01%)
Tryptophan (Trp, W)
n = 8 (2.47%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.4%)
Asparagine (Asn, N)
n = 12 (3.7%)
Glutamine (Gln, Q)
n = 5 (1.54%)
Histidine (His, H)
n = 2 (0.62%)
Lysine (Lys, K)
n = 7 (2.16%)
Arginine (Arg, R)
n = 8 (2.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 17 10 7 17 29 6 7 4 1 1 6 3 2 7 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 2 19 8 0 1 4 6 1 1 11 14 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 7 0 3 8 8 0 0 7 5 8 0 0 3 9 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 7 4 0 4 5 2 0 2 4 2 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 100 89 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 99 55 135
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 140 121 44
ND2 (size: 1041 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (3.18%)
Alanine (Ala, A)
n = 20 (5.78%)
Serine (Ser, S)
n = 35 (10.12%)
Threonine (Thr, T)
n = 48 (13.87%)
Cysteine (Cys, C)
n = 2 (0.58%)
Valine (Val, V)
n = 6 (1.73%)
Leucine (Leu, L)
n = 68 (19.65%)
Isoleucine (Ile, I)
n = 37 (10.69%)
Methionine (Met, M)
n = 18 (5.2%)
Proline (Pro, P)
n = 19 (5.49%)
Phenylalanine (Phe, F)
n = 11 (3.18%)
Tyrosine (Tyr, Y)
n = 5 (1.45%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 13 (3.76%)
Glutamine (Gln, Q)
n = 11 (3.18%)
Histidine (His, H)
n = 9 (2.6%)
Lysine (Lys, K)
n = 13 (3.76%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 27 13 3 24 31 1 8 10 1 0 2 4 0 0 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 2 1 10 7 2 0 6 5 0 0 9 9 1 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
23 16 0 1 14 14 1 0 5 2 3 0 1 2 11 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 4 1 0 1 12 1 0 0 4 0 0 0 0 1 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
43 102 134 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 117 58 140
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 154 147 31
ND3 (size: 1041 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (3.18%)
Alanine (Ala, A)
n = 20 (5.78%)
Serine (Ser, S)
n = 35 (10.12%)
Threonine (Thr, T)
n = 48 (13.87%)
Cysteine (Cys, C)
n = 2 (0.58%)
Valine (Val, V)
n = 6 (1.73%)
Leucine (Leu, L)
n = 68 (19.65%)
Isoleucine (Ile, I)
n = 37 (10.69%)
Methionine (Met, M)
n = 18 (5.2%)
Proline (Pro, P)
n = 19 (5.49%)
Phenylalanine (Phe, F)
n = 11 (3.18%)
Tyrosine (Tyr, Y)
n = 5 (1.45%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 13 (3.76%)
Glutamine (Gln, Q)
n = 11 (3.18%)
Histidine (His, H)
n = 9 (2.6%)
Lysine (Lys, K)
n = 13 (3.76%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 27 13 3 24 31 1 8 10 1 0 2 4 0 0 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 2 1 10 7 2 0 6 5 0 0 9 9 1 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
23 16 0 1 14 14 1 0 5 2 3 0 1 2 11 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 4 1 0 1 12 1 0 0 4 0 0 0 0 1 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
43 102 134 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 117 58 140
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 154 147 31
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.93%)
Alanine (Ala, A)
n = 30 (6.55%)
Serine (Ser, S)
n = 43 (9.39%)
Threonine (Thr, T)
n = 50 (10.92%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 10 (2.18%)
Leucine (Leu, L)
n = 97 (21.18%)
Isoleucine (Ile, I)
n = 40 (8.73%)
Methionine (Met, M)
n = 26 (5.68%)
Proline (Pro, P)
n = 30 (6.55%)
Phenylalanine (Phe, F)
n = 13 (2.84%)
Tyrosine (Tyr, Y)
n = 14 (3.06%)
Tryptophan (Trp, W)
n = 12 (2.62%)
Aspartic acid (Asp, D)
n = 2 (0.44%)
Glutamic acid (Glu, E)
n = 10 (2.18%)
Asparagine (Asn, N)
n = 13 (2.84%)
Glutamine (Gln, Q)
n = 10 (2.18%)
Histidine (His, H)
n = 16 (3.49%)
Lysine (Lys, K)
n = 11 (2.4%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 32 22 9 28 42 4 12 10 0 1 4 5 0 2 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 3 5 13 12 0 2 10 6 0 3 16 11 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
24 18 0 5 15 11 1 1 10 2 12 1 2 1 12 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 9 1 0 2 10 1 0 3 7 1 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 150 151 88
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
55 142 76 186
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 206 186 52
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 10 (10.2%)
Serine (Ser, S)
n = 13 (13.27%)
Threonine (Thr, T)
n = 5 (5.1%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 3 (3.06%)
Leucine (Leu, L)
n = 18 (18.37%)
Isoleucine (Ile, I)
n = 4 (4.08%)
Methionine (Met, M)
n = 6 (6.12%)
Proline (Pro, P)
n = 5 (5.1%)
Phenylalanine (Phe, F)
n = 8 (8.16%)
Tyrosine (Tyr, Y)
n = 1 (1.02%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 3 (3.06%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 6 (6.12%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 4 5 2 2 14 0 0 2 0 0 0 3 0 0 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 3 2 4 4 0 0 3 1 0 1 2 2 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 4 0 5 1 3 0 0 4 1 0 0 0 0 3 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 2 1 0 1 0 0 0 0 2 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
21 33 22 23
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
14 29 17 39
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 41 44 12
ND5 (size: 1818 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 32 (5.29%)
Alanine (Ala, A)
n = 46 (7.6%)
Serine (Ser, S)
n = 49 (8.1%)
Threonine (Thr, T)
n = 72 (11.9%)
Cysteine (Cys, C)
n = 6 (0.99%)
Valine (Val, V)
n = 9 (1.49%)
Leucine (Leu, L)
n = 104 (17.19%)
Isoleucine (Ile, I)
n = 60 (9.92%)
Methionine (Met, M)
n = 29 (4.79%)
Proline (Pro, P)
n = 37 (6.12%)
Phenylalanine (Phe, F)
n = 30 (4.96%)
Tyrosine (Tyr, Y)
n = 11 (1.82%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 7 (1.16%)
Glutamic acid (Glu, E)
n = 14 (2.31%)
Asparagine (Asn, N)
n = 24 (3.97%)
Glutamine (Gln, Q)
n = 15 (2.48%)
Histidine (His, H)
n = 17 (2.81%)
Lysine (Lys, K)
n = 23 (3.8%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 39 27 14 33 43 5 9 14 1 2 3 4 0 10 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 5 9 21 16 0 2 15 14 1 4 20 13 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
34 27 2 3 21 14 0 0 11 0 11 1 0 7 17 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 12 2 0 7 22 1 0 3 5 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
108 172 219 107
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
69 193 112 232
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 273 232 86
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (15.61%)
Alanine (Ala, A)
n = 13 (7.51%)
Serine (Ser, S)
n = 12 (6.94%)
Threonine (Thr, T)
n = 2 (1.16%)
Cysteine (Cys, C)
n = 3 (1.73%)
Valine (Val, V)
n = 37 (21.39%)
Leucine (Leu, L)
n = 26 (15.03%)
Isoleucine (Ile, I)
n = 3 (1.73%)
Methionine (Met, M)
n = 5 (2.89%)
Proline (Pro, P)
n = 4 (2.31%)
Phenylalanine (Phe, F)
n = 13 (7.51%)
Tyrosine (Tyr, Y)
n = 8 (4.62%)
Tryptophan (Trp, W)
n = 6 (3.47%)
Aspartic acid (Asp, D)
n = 5 (2.89%)
Glutamic acid (Glu, E)
n = 2 (1.16%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 1 (0.58%)
Arginine (Arg, R)
n = 5 (2.89%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 0 1 2 1 2 2 6 0 0 14 1 2 20 13 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 3 0 6 0 1 6 4 1 3 19 3 0 0 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 0 6 1 2 1 2 0 8 0 3 13 1 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 2 5 0 0 1 1 0 0 4 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
84 16 14 60
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 29 18 84
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
76 4 21 73
Total protein-coding genes (size: 11390 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 215 (5.67%)
Alanine (Ala, A)
n = 289 (7.62%)
Serine (Ser, S)
n = 295 (7.77%)
Threonine (Thr, T)
n = 349 (9.2%)
Cysteine (Cys, C)
n = 28 (0.74%)
Valine (Val, V)
n = 160 (4.22%)
Leucine (Leu, L)
n = 664 (17.5%)
Isoleucine (Ile, I)
n = 304 (8.01%)
Methionine (Met, M)
n = 168 (4.43%)
Proline (Pro, P)
n = 235 (6.19%)
Phenylalanine (Phe, F)
n = 219 (5.77%)
Tyrosine (Tyr, Y)
n = 106 (2.79%)
Tryptophan (Trp, W)
n = 108 (2.85%)
Aspartic acid (Asp, D)
n = 64 (1.69%)
Glutamic acid (Glu, E)
n = 94 (2.48%)
Asparagine (Asn, N)
n = 126 (3.32%)
Glutamine (Gln, Q)
n = 86 (2.27%)
Histidine (His, H)
n = 113 (2.98%)
Lysine (Lys, K)
n = 90 (2.37%)
Arginine (Arg, R)
n = 72 (1.9%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
86 218 135 78 185 288 35 62 80 6 31 45 57 27 59 160
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
33 5 23 42 144 94 9 20 79 87 29 21 108 103 3 55
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
164 126 4 35 101 98 4 3 54 26 80 12 16 22 104 26
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
87 78 16 11 53 79 11 1 16 45 10 0 1 9 1 96
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
822 1092 1095 787
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
481 1111 689 1515
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
217 1621 1437 521

Failed to understand id: ?term=("Gallus gallus"[Organism]) AND (refseq[filter] AND mitochondrion[filter])


Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.