Viewing data for Coturnix chinensis


Scientific name Coturnix chinensis
Common name King quail
Maximum lifespan 5.00 years (Coturnix chinensis@AnAge)

Total mtDNA (size: 16687 bases) GC AT G C A T
Base content (bases) 7447 9240 5199 2248 4065 5175
Base content per 1 kb (bases) 446 554 312 135 244 310
Base content (%) 44.6% 55.4%
Total protein-coding genes (size: 11378 bases) GC AT G C A T
Base content (bases) 5134 6244 3784 1350 2783 3461
Base content per 1 kb (bases) 451 549 333 119 245 304
Base content (%) 45.1% 54.9%
D-loop (size: 1150 bases) GC AT G C A T
Base content (bases) 458 692 293 165 381 311
Base content per 1 kb (bases) 398 602 255 143 331 270
Base content (%) 39.8% 60.2%
Total tRNA-coding genes (size: 1547 bases) GC AT G C A T
Base content (bases) 663 884 394 269 375 509
Base content per 1 kb (bases) 429 571 255 174 242 329
Base content (%) 42.9% 57.1%
Total rRNA-coding genes (size: 2580 bases) GC AT G C A T
Base content (bases) 1182 1398 715 467 521 877
Base content per 1 kb (bases) 458 542 277 181 202 340
Base content (%) 45.8% 54.2%
12S rRNA gene (size: 973 bases) GC AT G C A T
Base content (bases) 441 532 265 176 193 339
Base content per 1 kb (bases) 453 547 272 181 198 348
Base content (%) 45.3% 54.7%
16S rRNA gene (size: 1607 bases) GC AT G C A T
Base content (bases) 741 866 450 291 328 538
Base content per 1 kb (bases) 461 539 280 181 204 335
Base content (%) 46.1% 53.9%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 313 371 246 67 174 197
Base content per 1 kb (bases) 458 542 360 98 254 288
Base content (%) 45.8% 54.2%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 69 99 57 12 38 61
Base content per 1 kb (bases) 411 589 339 71 226 363
Base content (%) 41.1% 58.9%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 729 822 478 251 402 420
Base content per 1 kb (bases) 470 530 308 162 259 271
Base content (%) 47.0% 53.0%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 312 372 210 102 162 210
Base content per 1 kb (bases) 456 544 307 149 237 307
Base content (%) 45.6% 54.4%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 348 436 234 114 218 218
Base content per 1 kb (bases) 444 556 298 145 278 278
Base content (%) 44.4% 55.6%
CYTB (size: 1143 bases) GC AT G C A T
Base content (bases) 536 607 400 136 279 328
Base content per 1 kb (bases) 469 531 350 119 244 287
Base content (%) 46.9% 53.1%
ND1 (size: 975 bases) GC AT G C A T
Base content (bases) 444 531 321 123 272 259
Base content per 1 kb (bases) 455 545 329 126 279 266
Base content (%) 45.5% 54.5%
ND2 (size: 1041 bases) GC AT G C A T
Base content (bases) 439 602 351 88 263 339
Base content per 1 kb (bases) 422 578 337 85 253 326
Base content (%) 42.2% 57.8%
ND3 (size: 352 bases) GC AT G C A T
Base content (bases) 161 191 117 44 91 100
Base content per 1 kb (bases) 457 543 332 125 259 284
Base content (%) 45.7% 54.3%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 591 787 459 132 343 444
Base content per 1 kb (bases) 429 571 333 96 249 322
Base content (%) 42.9% 57.1%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 137 160 102 35 74 86
Base content per 1 kb (bases) 461 539 343 118 249 290
Base content (%) 46.1% 53.9%
ND5 (size: 1818 bases) GC AT G C A T
Base content (bases) 825 993 619 206 413 580
Base content per 1 kb (bases) 454 546 340 113 227 319
Base content (%) 45.4% 54.6%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 234 288 192 42 59 229
Base content per 1 kb (bases) 448 552 368 80 113 439
Base content (%) 44.8% 55.2%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 17 (7.49%)
Serine (Ser, S)
n = 15 (6.61%)
Threonine (Thr, T)
n = 22 (9.69%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 6 (2.64%)
Leucine (Leu, L)
n = 60 (26.43%)
Isoleucine (Ile, I)
n = 19 (8.37%)
Methionine (Met, M)
n = 13 (5.73%)
Proline (Pro, P)
n = 18 (7.93%)
Phenylalanine (Phe, F)
n = 7 (3.08%)
Tyrosine (Tyr, Y)
n = 4 (1.76%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 9 (3.96%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 13 9 10 14 27 1 7 7 1 1 3 2 0 3 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 3 10 4 0 1 4 2 1 3 5 10 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 8 0 1 6 4 0 1 3 0 4 1 1 2 7 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 0 1 0 3 0 0 3 3 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
36 87 70 35
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
22 68 33 105
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 91 94 34
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPAPWFTIMLMTWLTFSLLIQPKLLSFISTNNPSNKTTATTKPTPWTWPWI*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 2 (3.64%)
Serine (Ser, S)
n = 4 (7.27%)
Threonine (Thr, T)
n = 10 (18.18%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 7 (12.73%)
Isoleucine (Ile, I)
n = 4 (7.27%)
Methionine (Met, M)
n = 3 (5.45%)
Proline (Pro, P)
n = 8 (14.55%)
Phenylalanine (Phe, F)
n = 3 (5.45%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 4 (7.27%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 3 (5.45%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 4 1 2 3 1 0 1 2 0 0 0 0 0 1 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 0 0 2 0 0 0 0 0 2 1 5 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 4 2 0 1 2 1 0 0 0 0 0 0 1 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 0 0 3 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
2 16 24 14
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 24 10 17
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 17 27 7
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.11%)
Alanine (Ala, A)
n = 46 (8.91%)
Serine (Ser, S)
n = 26 (5.04%)
Threonine (Thr, T)
n = 41 (7.95%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 34 (6.59%)
Leucine (Leu, L)
n = 64 (12.4%)
Isoleucine (Ile, I)
n = 41 (7.95%)
Methionine (Met, M)
n = 24 (4.65%)
Proline (Pro, P)
n = 31 (6.01%)
Phenylalanine (Phe, F)
n = 42 (8.14%)
Tyrosine (Tyr, Y)
n = 17 (3.29%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 15 (2.91%)
Glutamine (Gln, Q)
n = 9 (1.74%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 23 21 9 18 24 3 9 6 3 5 13 15 1 9 33
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 7 23 16 0 5 16 20 6 7 12 12 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 15 2 1 7 14 1 0 3 4 13 1 1 3 12 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 10 0 4 11 9 0 2 1 5 0 0 1 0 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
152 121 134 110
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 141 94 205
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 216 192 87
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 16 (7.05%)
Serine (Ser, S)
n = 19 (8.37%)
Threonine (Thr, T)
n = 15 (6.61%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 16 (7.05%)
Leucine (Leu, L)
n = 31 (13.66%)
Isoleucine (Ile, I)
n = 16 (7.05%)
Methionine (Met, M)
n = 10 (4.41%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 8 (3.52%)
Tyrosine (Tyr, Y)
n = 8 (3.52%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 13 (5.73%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 4 (1.76%)
Glutamine (Gln, Q)
n = 9 (3.96%)
Histidine (His, H)
n = 9 (3.96%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 9 9 3 9 15 2 2 9 0 2 3 9 2 3 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 3 5 7 4 0 2 0 5 1 2 5 5 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 5 0 3 5 7 2 0 2 2 6 1 0 0 4 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 15 0 4 9 4 0 0 2 2 1 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 65 51 44
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
23 61 63 81
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 84 96 37
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.31%)
Alanine (Ala, A)
n = 21 (8.08%)
Serine (Ser, S)
n = 20 (7.69%)
Threonine (Thr, T)
n = 23 (8.85%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 14 (5.38%)
Leucine (Leu, L)
n = 33 (12.69%)
Isoleucine (Ile, I)
n = 15 (5.77%)
Methionine (Met, M)
n = 9 (3.46%)
Proline (Pro, P)
n = 11 (4.23%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 9 (3.46%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 5 (1.92%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 4 (1.54%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 8 6 8 5 12 1 6 7 0 6 5 3 0 5 19
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 4 6 11 0 3 6 10 0 3 1 7 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 9 0 5 5 5 0 1 4 1 8 1 1 1 4 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 8 0 2 2 4 0 1 0 4 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 66 61 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 70 54 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 98 103 54
CYTB (size: 1143 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 23 (6.05%)
Alanine (Ala, A)
n = 28 (7.37%)
Serine (Ser, S)
n = 26 (6.84%)
Threonine (Thr, T)
n = 27 (7.11%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 13 (3.42%)
Leucine (Leu, L)
n = 65 (17.11%)
Isoleucine (Ile, I)
n = 32 (8.42%)
Methionine (Met, M)
n = 11 (2.89%)
Proline (Pro, P)
n = 27 (7.11%)
Phenylalanine (Phe, F)
n = 28 (7.37%)
Tyrosine (Tyr, Y)
n = 13 (3.42%)
Tryptophan (Trp, W)
n = 11 (2.89%)
Aspartic acid (Asp, D)
n = 7 (1.84%)
Glutamic acid (Glu, E)
n = 7 (1.84%)
Asparagine (Asn, N)
n = 20 (5.26%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 13 (3.42%)
Lysine (Lys, K)
n = 10 (2.63%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 25 9 6 17 31 4 7 7 1 1 4 7 1 5 23
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 3 19 6 0 0 12 9 2 1 8 18 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 10 0 2 12 10 0 0 2 2 11 0 0 4 16 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 7 0 1 6 9 1 3 0 5 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
78 114 102 87
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
47 106 79 149
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 180 147 43
ND1 (size: 975 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.7%)
Alanine (Ala, A)
n = 27 (8.33%)
Serine (Ser, S)
n = 30 (9.26%)
Threonine (Thr, T)
n = 24 (7.41%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 11 (3.4%)
Leucine (Leu, L)
n = 64 (19.75%)
Isoleucine (Ile, I)
n = 27 (8.33%)
Methionine (Met, M)
n = 15 (4.63%)
Proline (Pro, P)
n = 24 (7.41%)
Phenylalanine (Phe, F)
n = 19 (5.86%)
Tyrosine (Tyr, Y)
n = 13 (4.01%)
Tryptophan (Trp, W)
n = 8 (2.47%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.4%)
Asparagine (Asn, N)
n = 12 (3.7%)
Glutamine (Gln, Q)
n = 5 (1.54%)
Histidine (His, H)
n = 2 (0.62%)
Lysine (Lys, K)
n = 7 (2.16%)
Arginine (Arg, R)
n = 8 (2.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 19 12 12 13 25 3 10 3 2 1 5 3 2 7 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 9 15 3 0 2 3 3 4 6 6 11 1 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 6 0 1 12 9 1 2 5 4 9 2 1 5 7 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 9 2 1 3 6 1 2 1 5 0 0 0 1 0 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
65 92 92 76
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 98 55 136
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 131 112 60
ND2 (size: 1041 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.47%)
Alanine (Ala, A)
n = 21 (6.07%)
Serine (Ser, S)
n = 39 (11.27%)
Threonine (Thr, T)
n = 44 (12.72%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 7 (2.02%)
Leucine (Leu, L)
n = 66 (19.08%)
Isoleucine (Ile, I)
n = 36 (10.4%)
Methionine (Met, M)
n = 17 (4.91%)
Proline (Pro, P)
n = 21 (6.07%)
Phenylalanine (Phe, F)
n = 12 (3.47%)
Tyrosine (Tyr, Y)
n = 6 (1.73%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 12 (3.47%)
Glutamine (Gln, Q)
n = 10 (2.89%)
Histidine (His, H)
n = 9 (2.6%)
Lysine (Lys, K)
n = 13 (3.76%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 25 14 9 15 33 2 7 10 0 1 4 2 0 4 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 3 8 10 0 1 3 7 1 2 7 12 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 20 0 8 13 12 1 2 3 2 4 0 0 1 11 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 3 2 0 1 13 0 1 1 2 0 0 0 0 1 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
46 103 127 71
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 120 57 138
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 128 155 54
ND3 (size: 1041 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.47%)
Alanine (Ala, A)
n = 21 (6.07%)
Serine (Ser, S)
n = 39 (11.27%)
Threonine (Thr, T)
n = 44 (12.72%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 7 (2.02%)
Leucine (Leu, L)
n = 66 (19.08%)
Isoleucine (Ile, I)
n = 36 (10.4%)
Methionine (Met, M)
n = 17 (4.91%)
Proline (Pro, P)
n = 21 (6.07%)
Phenylalanine (Phe, F)
n = 12 (3.47%)
Tyrosine (Tyr, Y)
n = 6 (1.73%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 12 (3.47%)
Glutamine (Gln, Q)
n = 10 (2.89%)
Histidine (His, H)
n = 9 (2.6%)
Lysine (Lys, K)
n = 13 (3.76%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 25 14 9 15 33 2 7 10 0 1 4 2 0 4 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 3 8 10 0 1 3 7 1 2 7 12 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 20 0 8 13 12 1 2 3 2 4 0 0 1 11 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 3 2 0 1 13 0 1 1 2 0 0 0 0 1 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
46 103 127 71
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 120 57 138
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 128 155 54
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.93%)
Alanine (Ala, A)
n = 28 (6.11%)
Serine (Ser, S)
n = 42 (9.17%)
Threonine (Thr, T)
n = 52 (11.35%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 12 (2.62%)
Leucine (Leu, L)
n = 98 (21.4%)
Isoleucine (Ile, I)
n = 37 (8.08%)
Methionine (Met, M)
n = 28 (6.11%)
Proline (Pro, P)
n = 29 (6.33%)
Phenylalanine (Phe, F)
n = 13 (2.84%)
Tyrosine (Tyr, Y)
n = 13 (2.84%)
Tryptophan (Trp, W)
n = 12 (2.62%)
Aspartic acid (Asp, D)
n = 2 (0.44%)
Glutamic acid (Glu, E)
n = 9 (1.97%)
Asparagine (Asn, N)
n = 13 (2.84%)
Glutamine (Gln, Q)
n = 12 (2.62%)
Histidine (His, H)
n = 17 (3.71%)
Lysine (Lys, K)
n = 11 (2.4%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 26 26 16 21 37 5 19 12 0 2 3 7 0 1 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 5 11 12 0 3 6 9 0 7 7 15 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
26 22 0 2 11 18 0 0 11 2 11 1 0 3 10 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 9 0 2 0 10 1 0 2 8 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 147 152 91
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
54 140 77 188
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 172 215 63
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 8 (8.16%)
Serine (Ser, S)
n = 13 (13.27%)
Threonine (Thr, T)
n = 8 (8.16%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 2 (2.04%)
Leucine (Leu, L)
n = 17 (17.35%)
Isoleucine (Ile, I)
n = 4 (4.08%)
Methionine (Met, M)
n = 7 (7.14%)
Proline (Pro, P)
n = 5 (5.1%)
Phenylalanine (Phe, F)
n = 8 (8.16%)
Tyrosine (Tyr, Y)
n = 1 (1.02%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 3 (3.06%)
Glutamine (Gln, Q)
n = 3 (3.06%)
Histidine (His, H)
n = 6 (6.12%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 4 6 0 2 11 1 3 3 0 0 0 2 0 3 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 2 1 3 4 0 0 3 1 0 1 2 2 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 5 0 2 4 3 0 0 4 0 1 1 0 0 3 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 1 1 0 1 0 0 0 1 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
17 30 26 26
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
14 30 17 38
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 42 43 10
ND5 (size: 1818 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 32 (5.29%)
Alanine (Ala, A)
n = 50 (8.26%)
Serine (Ser, S)
n = 40 (6.61%)
Threonine (Thr, T)
n = 74 (12.23%)
Cysteine (Cys, C)
n = 5 (0.83%)
Valine (Val, V)
n = 11 (1.82%)
Leucine (Leu, L)
n = 110 (18.18%)
Isoleucine (Ile, I)
n = 58 (9.59%)
Methionine (Met, M)
n = 28 (4.63%)
Proline (Pro, P)
n = 31 (5.12%)
Phenylalanine (Phe, F)
n = 31 (5.12%)
Tyrosine (Tyr, Y)
n = 13 (2.15%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 9 (1.49%)
Glutamic acid (Glu, E)
n = 12 (1.98%)
Asparagine (Asn, N)
n = 25 (4.13%)
Glutamine (Gln, Q)
n = 17 (2.81%)
Histidine (His, H)
n = 13 (2.15%)
Lysine (Lys, K)
n = 24 (3.97%)
Arginine (Arg, R)
n = 10 (1.65%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 42 24 12 35 47 2 14 14 3 3 2 6 0 6 25
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 2 3 6 28 13 3 1 9 19 3 3 9 18 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
39 30 1 3 12 15 1 0 9 4 9 2 0 2 23 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 11 1 2 7 21 3 3 2 5 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
114 167 218 107
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
68 186 114 238
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 266 248 68
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (14.45%)
Alanine (Ala, A)
n = 10 (5.78%)
Serine (Ser, S)
n = 13 (7.51%)
Threonine (Thr, T)
n = 3 (1.73%)
Cysteine (Cys, C)
n = 4 (2.31%)
Valine (Val, V)
n = 40 (23.12%)
Leucine (Leu, L)
n = 24 (13.87%)
Isoleucine (Ile, I)
n = 4 (2.31%)
Methionine (Met, M)
n = 4 (2.31%)
Proline (Pro, P)
n = 4 (2.31%)
Phenylalanine (Phe, F)
n = 15 (8.67%)
Tyrosine (Tyr, Y)
n = 8 (4.62%)
Tryptophan (Trp, W)
n = 5 (2.89%)
Aspartic acid (Asp, D)
n = 4 (2.31%)
Glutamic acid (Glu, E)
n = 2 (1.16%)
Asparagine (Asn, N)
n = 2 (1.16%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 1 (0.58%)
Arginine (Arg, R)
n = 5 (2.89%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 0 0 2 0 0 1 6 0 0 14 0 10 16 14 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 3 1 4 0 0 6 8 0 4 13 2 0 0 2 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 1 0 9 0 0 1 3 0 8 0 2 15 1 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 2 4 0 0 1 1 0 0 4 0 1 0 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
81 12 18 63
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 27 17 87
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
68 3 24 79
Total protein-coding genes (size: 11396 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 213 (5.61%)
Alanine (Ala, A)
n = 282 (7.43%)
Serine (Ser, S)
n = 294 (7.74%)
Threonine (Thr, T)
n = 357 (9.4%)
Cysteine (Cys, C)
n = 26 (0.68%)
Valine (Val, V)
n = 169 (4.45%)
Leucine (Leu, L)
n = 665 (17.51%)
Isoleucine (Ile, I)
n = 300 (7.9%)
Methionine (Met, M)
n = 173 (4.56%)
Proline (Pro, P)
n = 229 (6.03%)
Phenylalanine (Phe, F)
n = 219 (5.77%)
Tyrosine (Tyr, Y)
n = 107 (2.82%)
Tryptophan (Trp, W)
n = 107 (2.82%)
Aspartic acid (Asp, D)
n = 64 (1.69%)
Glutamic acid (Glu, E)
n = 91 (2.4%)
Asparagine (Asn, N)
n = 126 (3.32%)
Glutamine (Gln, Q)
n = 94 (2.48%)
Histidine (His, H)
n = 108 (2.84%)
Lysine (Lys, K)
n = 90 (2.37%)
Arginine (Arg, R)
n = 73 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
95 205 139 93 159 273 26 95 84 10 36 42 68 23 63 156
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
34 8 18 50 137 86 9 26 64 92 31 40 65 119 5 42
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
170 139 6 38 90 102 8 9 47 30 77 12 19 25 101 21
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
87 83 8 21 43 83 7 13 13 42 5 0 2 8 1 95
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
819 1055 1104 820
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
477 1106 689 1526
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
206 1474 1508 610

Failed to understand id: ?term=("Coturnix chinensis"[Organism]) AND (refseq[filter] AND mitochondrion[filter])


Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.