Viewing data for Corvus cornix


Scientific name Corvus cornix
Common name Hooded crow
Maximum lifespan 16.80 years (Corvus cornix@AnAge)

Total mtDNA (size: 16946 bases) GC AT G C A T
Base content (bases) 7539 9407 5070 2469 4192 5215
Base content per 1 kb (bases) 445 555 299 146 247 308
Base content (%) 44.5% 55.5%
Total protein-coding genes (size: 11381 bases) GC AT G C A T
Base content (bases) 5154 6227 3663 1491 2817 3410
Base content per 1 kb (bases) 453 547 322 131 248 300
Base content (%) 45.3% 54.7%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1556 bases) GC AT G C A T
Base content (bases) 631 925 363 268 404 521
Base content per 1 kb (bases) 406 594 233 172 260 335
Base content (%) 40.6% 59.4%
Total rRNA-coding genes (size: 2580 bases) GC AT G C A T
Base content (bases) 1165 1415 627 538 565 850
Base content per 1 kb (bases) 452 548 243 209 219 329
Base content (%) 45.2% 54.8%
12S rRNA gene (size: 978 bases) GC AT G C A T
Base content (bases) 470 508 259 211 207 301
Base content per 1 kb (bases) 481 519 265 216 212 308
Base content (%) 48.1% 51.9%
16S rRNA gene (size: 1602 bases) GC AT G C A T
Base content (bases) 695 907 368 327 358 549
Base content per 1 kb (bases) 434 566 230 204 223 343
Base content (%) 43.4% 56.6%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 297 387 229 68 172 215
Base content per 1 kb (bases) 434 566 335 99 251 314
Base content (%) 43.4% 56.6%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 70 98 60 10 40 58
Base content per 1 kb (bases) 417 583 357 60 238 345
Base content (%) 41.7% 58.3%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 720 831 464 256 386 445
Base content per 1 kb (bases) 464 536 299 165 249 287
Base content (%) 46.4% 53.6%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 316 368 207 109 161 207
Base content per 1 kb (bases) 462 538 303 159 235 303
Base content (%) 46.2% 53.8%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 372 412 247 125 202 210
Base content per 1 kb (bases) 474 526 315 159 258 268
Base content (%) 47.4% 52.6%
CYTB (size: 1143 bases) GC AT G C A T
Base content (bases) 518 625 371 147 291 334
Base content per 1 kb (bases) 453 547 325 129 255 292
Base content (%) 45.3% 54.7%
ND1 (size: 978 bases) GC AT G C A T
Base content (bases) 435 543 300 135 267 276
Base content per 1 kb (bases) 445 555 307 138 273 282
Base content (%) 44.5% 55.5%
ND2 (size: 1041 bases) GC AT G C A T
Base content (bases) 465 576 350 115 266 310
Base content per 1 kb (bases) 447 553 336 110 256 298
Base content (%) 44.7% 55.3%
ND3 (size: 350 bases) GC AT G C A T
Base content (bases) 148 202 99 49 100 102
Base content per 1 kb (bases) 423 577 283 140 286 291
Base content (%) 42.3% 57.7%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 619 759 462 157 324 435
Base content per 1 kb (bases) 449 551 335 114 235 316
Base content (%) 44.9% 55.1%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 146 151 107 39 76 75
Base content per 1 kb (bases) 492 508 360 131 256 253
Base content (%) 49.2% 50.8%
ND5 (size: 1818 bases) GC AT G C A T
Base content (bases) 805 1013 587 218 456 557
Base content per 1 kb (bases) 443 557 323 120 251 306
Base content (%) 44.3% 55.7%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 248 274 183 65 80 194
Base content per 1 kb (bases) 475 525 351 125 153 372
Base content (%) 47.5% 52.5%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 16 (7.05%)
Serine (Ser, S)
n = 17 (7.49%)
Threonine (Thr, T)
n = 23 (10.13%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (3.96%)
Leucine (Leu, L)
n = 60 (26.43%)
Isoleucine (Ile, I)
n = 19 (8.37%)
Methionine (Met, M)
n = 9 (3.96%)
Proline (Pro, P)
n = 15 (6.61%)
Phenylalanine (Phe, F)
n = 9 (3.96%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 10 (4.41%)
Glutamine (Gln, Q)
n = 9 (3.96%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 15 8 6 8 39 2 5 9 0 0 4 3 2 1 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 2 10 4 0 4 1 2 1 2 4 9 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 13 0 1 4 6 0 1 5 0 3 1 0 2 8 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 4 0 1 0 3 0 2 1 2 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
38 87 70 33
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
23 65 34 106
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 77 111 33
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPNPWFFIMLTSWLTYSMIIQPKLLSFISMNPPLNKAQTTKTTTPWTWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 1 (1.82%)
Serine (Ser, S)
n = 4 (7.27%)
Threonine (Thr, T)
n = 9 (16.36%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 6 (10.91%)
Isoleucine (Ile, I)
n = 4 (7.27%)
Methionine (Met, M)
n = 4 (7.27%)
Proline (Pro, P)
n = 8 (14.55%)
Phenylalanine (Phe, F)
n = 3 (5.45%)
Tyrosine (Tyr, Y)
n = 1 (1.82%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 4 (7.27%)
Glutamine (Gln, Q)
n = 3 (5.45%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 3 (5.45%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 3 2 0 2 4 0 0 2 1 0 0 0 0 2 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 0 1 0 0 0 0 0 0 3 1 4 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 1 0 0 3 0 1 0 0 0 1 0 0 1 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 0 0 3 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
1 17 24 14
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 22 12 17
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 21 22 9
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.11%)
Alanine (Ala, A)
n = 48 (9.3%)
Serine (Ser, S)
n = 27 (5.23%)
Threonine (Thr, T)
n = 36 (6.98%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 37 (7.17%)
Leucine (Leu, L)
n = 63 (12.21%)
Isoleucine (Ile, I)
n = 41 (7.95%)
Methionine (Met, M)
n = 23 (4.46%)
Proline (Pro, P)
n = 30 (5.81%)
Phenylalanine (Phe, F)
n = 43 (8.33%)
Tyrosine (Tyr, Y)
n = 17 (3.29%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 16 (3.1%)
Glutamine (Gln, Q)
n = 9 (1.74%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 28 14 7 10 43 3 0 9 0 4 10 19 4 7 36
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 0 1 10 18 19 1 5 9 30 3 4 2 23 1 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 13 0 3 12 9 0 0 3 4 13 0 0 4 12 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
18 10 0 2 13 9 0 2 0 6 0 0 1 0 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
157 129 129 102
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 138 95 207
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 197 221 77
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 17 (7.49%)
Serine (Ser, S)
n = 20 (8.81%)
Threonine (Thr, T)
n = 16 (7.05%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 18 (7.93%)
Leucine (Leu, L)
n = 30 (13.22%)
Isoleucine (Ile, I)
n = 13 (5.73%)
Methionine (Met, M)
n = 12 (5.29%)
Proline (Pro, P)
n = 12 (5.29%)
Phenylalanine (Phe, F)
n = 10 (4.41%)
Tyrosine (Tyr, Y)
n = 7 (3.08%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 13 (5.73%)
Glutamic acid (Glu, E)
n = 14 (6.17%)
Asparagine (Asn, N)
n = 5 (2.2%)
Glutamine (Gln, Q)
n = 7 (3.08%)
Histidine (His, H)
n = 8 (3.52%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 10 7 4 3 21 2 0 7 0 2 8 7 1 2 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 3 5 8 4 0 1 3 3 1 3 0 9 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 4 0 3 5 7 0 0 5 2 5 1 0 1 4 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 12 2 2 11 3 1 1 0 4 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 62 55 41
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 60 59 83
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 85 93 37
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 22 (8.46%)
Serine (Ser, S)
n = 15 (5.77%)
Threonine (Thr, T)
n = 22 (8.46%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 16 (6.15%)
Leucine (Leu, L)
n = 32 (12.31%)
Isoleucine (Ile, I)
n = 14 (5.38%)
Methionine (Met, M)
n = 10 (3.85%)
Proline (Pro, P)
n = 14 (5.38%)
Phenylalanine (Phe, F)
n = 22 (8.46%)
Tyrosine (Tyr, Y)
n = 12 (4.62%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 7 (2.69%)
Asparagine (Asn, N)
n = 4 (1.54%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 5 (1.92%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 11 6 5 9 14 3 1 6 1 5 4 7 0 3 19
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 5 9 8 0 2 8 7 3 4 2 8 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 10 0 4 4 2 1 1 3 6 6 0 0 0 4 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 6 1 2 3 5 0 1 1 3 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 73 59 59
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 69 56 94
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 105 95 48
CYTB (size: 1143 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.32%)
Alanine (Ala, A)
n = 29 (7.63%)
Serine (Ser, S)
n = 23 (6.05%)
Threonine (Thr, T)
n = 23 (6.05%)
Cysteine (Cys, C)
n = 4 (1.05%)
Valine (Val, V)
n = 18 (4.74%)
Leucine (Leu, L)
n = 64 (16.84%)
Isoleucine (Ile, I)
n = 34 (8.95%)
Methionine (Met, M)
n = 7 (1.84%)
Proline (Pro, P)
n = 25 (6.58%)
Phenylalanine (Phe, F)
n = 33 (8.68%)
Tyrosine (Tyr, Y)
n = 12 (3.16%)
Tryptophan (Trp, W)
n = 11 (2.89%)
Aspartic acid (Asp, D)
n = 8 (2.11%)
Glutamic acid (Glu, E)
n = 7 (1.84%)
Asparagine (Asn, N)
n = 20 (5.26%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 12 (3.16%)
Lysine (Lys, K)
n = 10 (2.63%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 23 6 5 12 42 5 0 8 0 3 6 9 0 6 27
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 3 3 14 10 2 3 4 15 2 5 6 13 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 13 1 4 9 8 0 1 1 2 10 0 0 4 16 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 7 0 0 8 10 0 0 1 7 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
86 117 96 82
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
49 98 78 156
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 156 160 53
ND1 (size: 978 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.31%)
Alanine (Ala, A)
n = 28 (8.62%)
Serine (Ser, S)
n = 26 (8.0%)
Threonine (Thr, T)
n = 17 (5.23%)
Cysteine (Cys, C)
n = 2 (0.62%)
Valine (Val, V)
n = 18 (5.54%)
Leucine (Leu, L)
n = 62 (19.08%)
Isoleucine (Ile, I)
n = 27 (8.31%)
Methionine (Met, M)
n = 13 (4.0%)
Proline (Pro, P)
n = 26 (8.0%)
Phenylalanine (Phe, F)
n = 18 (5.54%)
Tyrosine (Tyr, Y)
n = 15 (4.62%)
Tryptophan (Trp, W)
n = 8 (2.46%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.38%)
Asparagine (Asn, N)
n = 13 (4.0%)
Glutamine (Gln, Q)
n = 6 (1.85%)
Histidine (His, H)
n = 2 (0.62%)
Lysine (Lys, K)
n = 7 (2.15%)
Arginine (Arg, R)
n = 8 (2.46%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 15 8 5 10 38 6 3 5 1 4 2 12 0 4 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 1 4 12 12 0 1 4 7 2 5 9 12 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 6 1 5 9 6 0 1 5 9 6 1 0 4 9 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 8 3 1 3 6 1 2 2 4 0 0 1 0 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
75 101 84 66
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 91 58 138
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 108 134 63
ND2 (size: 1041 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.76%)
Alanine (Ala, A)
n = 27 (7.8%)
Serine (Ser, S)
n = 29 (8.38%)
Threonine (Thr, T)
n = 43 (12.43%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 10 (2.89%)
Leucine (Leu, L)
n = 66 (19.08%)
Isoleucine (Ile, I)
n = 33 (9.54%)
Methionine (Met, M)
n = 17 (4.91%)
Proline (Pro, P)
n = 22 (6.36%)
Phenylalanine (Phe, F)
n = 13 (3.76%)
Tyrosine (Tyr, Y)
n = 9 (2.6%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 12 (3.47%)
Glutamine (Gln, Q)
n = 10 (2.89%)
Histidine (His, H)
n = 9 (2.6%)
Lysine (Lys, K)
n = 13 (3.76%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 16 9 9 14 33 9 1 8 2 3 3 2 2 3 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 1 0 4 11 12 0 0 8 5 0 4 9 9 0 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 17 0 4 12 8 1 0 4 3 6 3 0 4 8 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 2 2 1 1 12 1 0 1 2 0 0 0 1 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
56 109 122 60
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 117 60 139
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 124 128 67
ND3 (size: 1041 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.76%)
Alanine (Ala, A)
n = 27 (7.8%)
Serine (Ser, S)
n = 29 (8.38%)
Threonine (Thr, T)
n = 43 (12.43%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 10 (2.89%)
Leucine (Leu, L)
n = 66 (19.08%)
Isoleucine (Ile, I)
n = 33 (9.54%)
Methionine (Met, M)
n = 17 (4.91%)
Proline (Pro, P)
n = 22 (6.36%)
Phenylalanine (Phe, F)
n = 13 (3.76%)
Tyrosine (Tyr, Y)
n = 9 (2.6%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 12 (3.47%)
Glutamine (Gln, Q)
n = 10 (2.89%)
Histidine (His, H)
n = 9 (2.6%)
Lysine (Lys, K)
n = 13 (3.76%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 16 9 9 14 33 9 1 8 2 3 3 2 2 3 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 1 0 4 11 12 0 0 8 5 0 4 9 9 0 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 17 0 4 12 8 1 0 4 3 6 3 0 4 8 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 2 2 1 1 12 1 0 1 2 0 0 0 1 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
56 109 122 60
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 117 60 139
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 124 128 67
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.93%)
Alanine (Ala, A)
n = 35 (7.64%)
Serine (Ser, S)
n = 35 (7.64%)
Threonine (Thr, T)
n = 42 (9.17%)
Cysteine (Cys, C)
n = 4 (0.87%)
Valine (Val, V)
n = 16 (3.49%)
Leucine (Leu, L)
n = 92 (20.09%)
Isoleucine (Ile, I)
n = 43 (9.39%)
Methionine (Met, M)
n = 29 (6.33%)
Proline (Pro, P)
n = 28 (6.11%)
Phenylalanine (Phe, F)
n = 13 (2.84%)
Tyrosine (Tyr, Y)
n = 12 (2.62%)
Tryptophan (Trp, W)
n = 12 (2.62%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 10 (2.18%)
Asparagine (Asn, N)
n = 16 (3.49%)
Glutamine (Gln, Q)
n = 13 (2.84%)
Histidine (His, H)
n = 17 (3.71%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 28 23 7 18 53 12 2 12 1 1 5 10 0 4 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 3 5 16 14 0 2 7 9 0 2 11 15 0 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 18 0 4 14 7 1 1 8 3 9 0 0 1 15 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 10 0 0 3 9 1 0 0 11 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
82 159 149 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
54 131 81 193
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 172 205 61
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 3 (3.06%)
Alanine (Ala, A)
n = 12 (12.24%)
Serine (Ser, S)
n = 13 (13.27%)
Threonine (Thr, T)
n = 9 (9.18%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 1 (1.02%)
Leucine (Leu, L)
n = 22 (22.45%)
Isoleucine (Ile, I)
n = 3 (3.06%)
Methionine (Met, M)
n = 6 (6.12%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 6 (6.12%)
Tyrosine (Tyr, Y)
n = 1 (1.02%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 4 (4.08%)
Histidine (His, H)
n = 5 (5.1%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 3 4 2 2 11 3 4 4 0 1 0 0 0 3 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 3 6 3 0 0 3 0 0 0 1 0 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 4 0 2 6 1 0 0 4 0 1 0 0 0 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 2 0 0 1 0 0 0 1 0 1 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
19 31 24 25
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
13 32 16 38
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 44 35 13
ND5 (size: 1818 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 33 (5.45%)
Alanine (Ala, A)
n = 48 (7.93%)
Serine (Ser, S)
n = 51 (8.43%)
Threonine (Thr, T)
n = 57 (9.42%)
Cysteine (Cys, C)
n = 8 (1.32%)
Valine (Val, V)
n = 20 (3.31%)
Leucine (Leu, L)
n = 100 (16.53%)
Isoleucine (Ile, I)
n = 55 (9.09%)
Methionine (Met, M)
n = 31 (5.12%)
Proline (Pro, P)
n = 30 (4.96%)
Phenylalanine (Phe, F)
n = 39 (6.45%)
Tyrosine (Tyr, Y)
n = 13 (2.15%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 10 (1.65%)
Glutamic acid (Glu, E)
n = 11 (1.82%)
Asparagine (Asn, N)
n = 26 (4.3%)
Glutamine (Gln, Q)
n = 19 (3.14%)
Histidine (His, H)
n = 13 (2.15%)
Lysine (Lys, K)
n = 20 (3.31%)
Arginine (Arg, R)
n = 9 (1.49%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 38 27 4 24 57 7 8 16 3 4 6 10 0 9 30
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 4 4 8 23 13 4 1 12 19 1 10 7 11 2 13
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
25 19 0 4 20 17 1 2 7 2 11 1 0 8 18 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 10 1 0 10 20 0 0 2 7 0 1 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
122 163 199 122
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
72 177 112 245
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 247 246 89
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (15.03%)
Alanine (Ala, A)
n = 13 (7.51%)
Serine (Ser, S)
n = 17 (9.83%)
Threonine (Thr, T)
n = 3 (1.73%)
Cysteine (Cys, C)
n = 2 (1.16%)
Valine (Val, V)
n = 35 (20.23%)
Leucine (Leu, L)
n = 25 (14.45%)
Isoleucine (Ile, I)
n = 4 (2.31%)
Methionine (Met, M)
n = 7 (4.05%)
Proline (Pro, P)
n = 4 (2.31%)
Phenylalanine (Phe, F)
n = 9 (5.2%)
Tyrosine (Tyr, Y)
n = 7 (4.05%)
Tryptophan (Trp, W)
n = 5 (2.89%)
Aspartic acid (Asp, D)
n = 4 (2.31%)
Glutamic acid (Glu, E)
n = 3 (1.73%)
Asparagine (Asn, N)
n = 4 (2.31%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 5 (2.89%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 0 3 3 0 3 10 9 0 0 15 0 6 14 8 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 2 0 2 1 5 5 6 1 5 14 3 0 0 1 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 2 1 9 0 1 4 2 1 6 1 1 0 3 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 2 4 0 0 0 0 0 0 5 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
81 25 21 47
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
41 34 19 80
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
61 6 40 67
Total protein-coding genes (size: 11398 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 219 (5.77%)
Alanine (Ala, A)
n = 304 (8.01%)
Serine (Ser, S)
n = 286 (7.53%)
Threonine (Thr, T)
n = 308 (8.11%)
Cysteine (Cys, C)
n = 30 (0.79%)
Valine (Val, V)
n = 201 (5.29%)
Leucine (Leu, L)
n = 649 (17.09%)
Isoleucine (Ile, I)
n = 299 (7.87%)
Methionine (Met, M)
n = 173 (4.56%)
Proline (Pro, P)
n = 223 (5.87%)
Phenylalanine (Phe, F)
n = 226 (5.95%)
Tyrosine (Tyr, Y)
n = 111 (2.92%)
Tryptophan (Trp, W)
n = 107 (2.82%)
Aspartic acid (Asp, D)
n = 69 (1.82%)
Glutamic acid (Glu, E)
n = 89 (2.34%)
Asparagine (Asn, N)
n = 135 (3.56%)
Glutamine (Gln, Q)
n = 99 (2.61%)
Histidine (His, H)
n = 104 (2.74%)
Lysine (Lys, K)
n = 85 (2.24%)
Arginine (Arg, R)
n = 71 (1.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
103 196 121 60 116 373 65 34 90 9 43 49 86 23 55 171
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
52 11 19 52 132 108 12 26 60 104 29 46 52 119 6 80
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
103 122 3 44 101 75 9 11 46 38 73 8 1 32 103 17
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
87 77 12 13 56 81 4 8 9 47 7 1 2 7 0 99
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
882 1111 1060 745
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
487 1064 699 1548
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
242 1373 1544 639

>NC_024698.1 Corvus cornix cornix isolate S_Up_H32 mitochondrion, complete genome
GGAGCAGCCGCTGCTCTCCTTACTACATCCGGCCTAACCATGTGATTCCACTATAACTCACCATACCTAC
TGATCATAGGACTCACTTCTACTGCCCTAGTTATACTCCAATGATGACGTGACATCATCCGAGAAAGTAC
ATTCCAAGGTCACCACACACCTACCGTACAAAAAGGCTTACGATATGGAATAGTCCTATTCATCACATCG
GAGGCCTTCTTCTTCCTAGGCTTCTTCTGAGCATTCTTCCACTCTAGCCTGGCCCCAACACCAGAACTAG
GAGGGCAGTGACCCCCAGTTGGAATTAAACCTCTAAACCCAATGGACGTCCCTCTTCTAAACACCGCCAT
CCTCCTTGCTTCAGGGGTTACAGTCACATGAGCACATCACAGCATCATAGAAGCCAACCGAAAACAAGCA
ATCCACGCCCTCACCCTTACAGTTCTCCTAGGCTTCTACTTCACCGGCCTACAAGCCATAGAATACTATG
AAGCTCCATTCTCCATTGCCGATGGGGTATATGGCTCTACCTTCTTCGTAGCAACTGGATTCCACGGCCT
CCACGTAATCATCGGTTCCACATTCCTCCTAGTATGCCTTCTACGCCTGATCAAATATCACTTTACACCA
AAACACCACTTTGGCTTCGAAGCAGCAGCTTGATACTGACACTTTGTAGATGTCGTATGACTATTCCTCT
ATATGACTATCTACTGATGAGGATCCTACTCTTCTAGTATATTAATTACAATCGACTTCCAATCCTTAAA
ATCTGGTTTAAACCCAGAGAAGAGTAATGAACATAATCCTATTCATAATAATCTCATCTTTGACTCTAAG
TGTCATCCTCACTGCATTAAACTTTTGACTAGCACAAATAAACCCAGACTCAGAGAAACTATCCCCATAC
GAATGCGGGTTCGACCCACTAGGGTCCGCCCGGCTGCCATTTTCAATTCGATTCTTCCTAGTAGCAATCC
TATTCCTACTATTTGACCTAGAAATTGCCCTACTCCTTCCACTGCCATGAGCCATCCAACTACAAACTCC
TACCACTACACTAACATGAGCTTCCATCCTCATTCTTCTCCTTACTCTAGGTCTGGTTTATGAATGAAGT
CAAGGAGGACTAGAATGAGCAGAATAACAGAGAGTTAGTCTAATCAAGACAGTTGACTTCGACTCAACAG
ATTATAGCTCACACCCTATAACTCTCTTAATGTCTGCCCTACAATTAAGCTTTTTCTCCGCTTTCACCCT
AAGCAGCCTAGGCCTAGCCTTCCACCGCACACACTTAATCTCTGCCCTACTATGTCTGGAAAGCATGATA
TTATCCATATACATCGCCCTTTCCATATGACCCATCCAAACCCAAACAACATCCGCTACCCTCCTGCCGC
TTCTCATATTAGCATTTTCCGCCTGCGAAGCAGCAACAGGCCTAGCCCTGCTAGTTGCTTCAACTCGGAC
CCACGGCTCCGACCACCTACACAACTTTAACCTACTACAATGCTAAAAATCATCGTCCCAACCATCATAC
TCCTACCCCTAACCATCCTCTCTCCCTGCAAACACCTGTGAACTAACACCACAGCACACAGCCTACTAAT
TGCCGCTGTCAGCCTCCAATGACTTGTCCCAACATACTACCCAAGCAAAGGACTGACCCACTGAACTTCA
ATCGACCAAATCTCTTCCCCCCTACTAGTTCTATCGTGCTGACTACTTCCCCTCATACTCATAGCAAGCC
AAAACCACCTAGAACAAGAACCAATTATCCGAAAACGAGTCTTCATCACAACTATAATTACAGTACAACC
CTTTATCCTACTAGCTTTCTCAGCCTCAGAATTAATACTATTCTACATTGCATTTGAAGCAACCCTCATT
CCAACCCTAATCCTCATTACACGATGAGGAAACCAACCTGAACGACTAAATGCAGGCATTTACCTGCTAT
TTTACACACTCGCCAGCTCTCTCCCCCTGCTAATCACAATTCTCCACCTACATAACCAAATCGGCACATT
ATACTTCCCCATACTCAAACTATCCCACCCAACAATAAACAACTCCTGAACAGGTCTACTAGCAAGCCTA
GCCCTACTACTAGCCTTCATGGTAAAAGCCCCCCTATACGGCCTACACCTATGACTTCCAAAAGCACACG
TAGAAGCCCCAATCGCTGGATCCATACTACTGGCCGCCCTTCTTCTAAAACTAGGCGGCTATGGTATTAT
ACGAATCACTATCCTAGTAGACCCATCCGTAAACAACCTACACTATCCATTCATCACCCTGGCACTATGA
GGAGCAGTAATGACCAGCGCCATTTGCCTACGACAAATTGACCTGAAGTCCCTAATCGCCTACTCCTCTG
TAAGCCACATAGGCCTAGTCATCGCCGCAACCATGATCCAGACTCAATGAGCTTTTTCAGGAGCAATAAT
CCTGATAATCTCCCACGGCCTAACTTCCTCAATACTATTCTGTCTGGCCAACACAAACTACGAACGAACT
CACAGTCGAATCCTCCTCCTAACTCGAGGACTCCAACCCCTCCTACCACTTATGGCTACCTGATGACTAC
TAGCAAACCTAACAAACATGGCACTACCACCAACAACCAACCTCATAGCAGAACTGACTATTGTAGTAGC
CCTATTCAACTGATCCCCACTGACAATAATTCTAACAGGAACTACAATTGTACTAACTGCCTCCTATACC
CTCCATATACTAATAATAACACAACGAGGAATACTACCATCCCATATCACCTCAATCCAAAACTCCTCCA
CACGAGAACATCTCCTGATAGCCCTACACATAATCCCCATAATCCTACTTATTTTCAAACCTGAACTAAT
CTCAGGAATCCCCATATGCAAGTATAGTTTAATCAAAACATTAGATTGTGATTCTAAAAATAGAAGTTAA
ACCCTTCTTACCTGCCGAGGGGAGGTTAAACCAGCAAGAACTGCTAACTCTTGCATCTGAGTATAAAACC
TCAGCCCCCTTACTTTCAAAGGATAATAGTAATCCAATGGTCTTAGGAACCAGTCATCTTGGTGCAAATC
CAAGTGAAAGTAATGGACCAAATATTTATCTTAAACACATTCATACTACTCACCCTAGCAGTCCTCTGTA
CCCCAATCATTTTCCCTATACTATCAGACAACCTAAAAAACACCCCAACTATTATTACAAACACTGTTAA
AACTTCCTTCCTAATTAGCCTTATCCCCATAACCATCTACATCCACTCAGGAATAGAAAGTCTAACTTCC
TTCTGGGAATGAAAATTCATTATAAACTTTAAAATTCCCATCAGCCTAACAATAGACTTCTACTCACTAA
CCTTCTTCCCAATCGCCCTATTTGTCTCCTGATCAATTCTACAATTTGCAACATGATACATGGCCTCGGA
CCCGCACATCACAAAATTTTTCACCTTCCTCCTCCTATTCCTCATTGCCATACTCATCCTCATTATCTCC
AACAACCTATTCCTGCTCTTCATCGGATGAGAGGGAGTAGGAATCATGTCCTTCCTACTAATCAGCTGAT
GACATGGCCGAGCAGAAGCAAATACCGCTGCCCTACAAGCCGTACTATACAACCGAGTTGGAGACGTAGG
CCTCATCCTGTGTATAGCCTGACTAGCCTCTACCATAAACACATGAGAAATTCAACAAATCTCATCCCAA
GACCAAACCCCTACCCTGCCTCTACTAGGCCTAATTTTAGCTGCGGCCGGCAAATCCGCCCAATTTGGCC
TCCACCCGTGACTCCCAGCAGCAATAGAAGGCCCAACCCCTGTATCCGCCCTACTTCACTCCAGCACCAT
AGTAGTCGCTGGAATCTTCCTACTCATCCGAACTCATCCCCTATTCCACAACAATCCTACTGCCCTATCC
CTATGTCTGTGCCTAGGGGCCCTCTCCACACTATTTGCAGCCACCTGCGCCCTGACCCAAAACGACATTA
AAAAAATCATTGCTTTCTCTACATCCAGCCAACTAGGCCTAATAATAGTTACAATTGGTTTAAACCTACC
CCAGCTGGCTTTCCTACACATTTCAACCCATGCGTTCTTCAAAGCCATACTATTCCTATGTTCCGGATCA
ATCATCCACAGCCTCAACGGCGAACAAGACATCCGAAAAATAGGAGGACTCCAAAAAATACTACCAACAA
CTACTTCCTGCTTAACCATCGGAAACCTAGCCCTAATGGGAACACCATTTCTAGCGGGATTCTACTCCAA
AGACCAAATCATCGAATGCCTCAACACTTCATACCTAAATGCTTGAGCCCTAGTTCTAACCCTCCTAGCC
ACATCATTCACCGCAGTATATACTATACGAATAACCCTACTAGTCCAAACAGGATACGTCCGAATTCCCC
CTCTAACCCCTATAAACGAAAATAACCCAGCAGTCCTCTCCTCAATTACTCGCCTCGCATTAGGAAGTAT
CATAGCAGGATTCCTAATCACCTCATACATCCCACCTGCAAAAACCCCACCCATAACTATACCACTTTCC
ATCAAAATCACAGCCCTTGTAGTAACACTACTAGGAATCATACTAGCCCTAGAACTCTCAAAAATAACTC
AGGCCTTAATCCTCCCTAAACAGAATCGCTTCTCAAATTTCTCCACAACCCTAGGATACTTTAATCCCCT
AGTACACCGATTCATCTCAACAAAACTATTAAGCGGCGGCCAAAATATCGCTTCCCACTTAATCGACCTC
TCTTGATACAAACTCATAGGCCCTGAAGGACTAGCCAACCTGCAAGTAATAGCATCAAAAACCGCCACCT
CCTTCCACACAGGCCTAATCAAAGCGTACCTAGGATCATTCGCTCTATCAATCTTCATCATCCTCCTATC
TACATATAGAACCAGACTTAATGGCCCTAAACCTACGAAAAAACCACCCGCTACTAAAAATCATCAACAA
CTCTCTAGTTGACCTTCCCACTCCATCAAACATTTCAGCTTGATGAAACTTTGGATCCCTACTAGGCCTT
TGCCTCATTACACAAATCATCACAGGTCTGCTACTAGCTATACACTACACAGCAGACACTTCTCTGGCCT
TCACCTCCGTAGCCCACACATGCCGAAACGTACAATTTGGATGACTAATTCGAAACCTCCACGCAAACGG
AGCCTCCTTCTTCTTCATTTGCATCTACCTACACATCGGCCGAGGATTTTATTACGGTTCATACCTAAAC
AAAGAAACCTGAAACATCGGAGTAATTCTTCTCCTAACACTAATAGCAACCGCCTTCGTAGGGTACGTCC
TACCCTGAGGACAAATATCCTTCTGAGGAGCAACAGTCATCACAAATCTCTTCTCAGCAATCCCATACAT
CGGACAAACACTAGTAGAATGACTATGAGGCGGGTTCTCAGTAGACAACCCAACACTAACCCGATTTTTT
GCCTTCCACTTCCTCCTCCCATTCGTAATCGCAGGACTAACACTAGTACACCTAACCTTCCTTCACGAAA
CAGGCTCAAATAATCCACTAGGAATTCCCTCAGACTGTGACAAAATTCCATTCCATCCTTATTACTCCAT
CAAAGACCTACTAGGATTCGCACTAATACTCATCCCATTCATTGCCCTGGCTCTATTCTCCCCAAACCTC
CTAGGAGACCCAGAAAATTTCACGCCCGCCAACCCTCTAGCCACACCTCCACACATTAAACCTGAATGAT
ACTTCCTATTTGCATACGCCATTCTTCGATCCATCCCAAACAAACTAGGAGGAGTCCTGGCCCTAGCCGC
CTCAGTCCTAGTCCTATTCCTACTGCCTTTCCTCCACGTTTCTAAACAACGCTCCATAACTTTCCGACCC
CTATCTCAAATCCTATTCTGAATTCTAGTTGCAGACCTATTCATCCTAACATGAGTAGGAAGCCAACCAG
TCGAACATCCATTCATCATCATCGGTCAACTAGCCTCCTTCACCTACTTCGCAATCATCCTAATCCTCTT
CCCCATCGCGAGTGCGCTAGAAAACAAAATACTCAAACTCTAATCAACTCTAATAGTTTATAAAAACATT
GGTCTTGTAAGCCAAAGATTGAAGACTGAACATCTTCTTAGAGTTTCCACATAAATCAGAAAGAAAGGAG
TCAAACCTTTATCACCAGCTCCCAAAGCTGGCATTCTTAATTAAACTACTCTCTGACTTACCAATTAAAC
CGCCCGAATTGCCCCCCGAGACAGCCCCCGTACAAGTTCTAATACCACAAACAGTGTTAACAGCAGCCCT
CATCCTGCAATTAAAAGCAGACCCGATCCAGACGAATAAAACACGGCTACCCCGCTAAAATCTGTCCGAA
TTCACGATAGGCCCCCATTATTCACCGTATCCCCCCCTATAACCACCTCAGAAAACGCTCCCACAACAAC
CCCCACAACAACAACAACTAACCCCAGACCAAGACCATAACCAACAACCCGTCAATCACCCCAAGACTCC
GGATAAGGATCCGCTGCTAATGACACCGAGTAAACAAACACCACCAGCATCCCCCCTAAATATACCATCA
CCAGTACTAAAGACACAAAAGAAACCCCCATACTTGCTAGTCATGCACATCCAGCAATAGAAGCCACAAC
CAGACCCACCACCCCATAATAAGGAGAAGGGTTAGACGCAACCGCTAACCCTCCTAAAACAAAACACAGA
CTTATGAATAGTACAAAATTTATCATAAGTTCCCGCTTGGACCCTCCCCAAGACCTATGGCTTGAAAAGC
CATTGTTATAAAACTTTAACTACAGGAACTAAACCCTTCTCCTTACCTTTATACCTCTCTTTTCCCACCC
CCCCCTTACCCCCCCCATGTTTTTACATGGGATTTTGGCTATGTATTTCTTTGCATACAATTCTCGTCCA
CATTAGACATGATATGCATGTAGGATAACTCACATAACAAGTAATGCAAGACCCAACCAAACTCAAATAT
CATCGCCCATAACGATCCAAACGGACAGACAACCTTCCAGGCACATTCCCATCCCAGGTACAACAAACCC
AAGTGATCCTACCAACGACACAAGACAAGCTTCGCCCAAGATCGAGGATGATTCACCTTACATAACAACC
CACTCTAGCGAACGAGGAATATCCTAGTACTCCAATGAATCCTCAGTCCCATACGTTCCAGTCCATCCCC
ACAAAACCTTCCAGTCCTATCACTCTCAAGAGCTCCCAAGAAGAACCAGGTTATCTATTAATCGTAATCC
TCACGAGAACCGAGCTACTCAACGTAGGTGCTACCCACGGCTACCAGCTTCAGGACCATACTTTCCCCCT
ACACCCTCGCCCAACTTGCACTTTTGCGCCTCTGGTTCCTATTTCAGGGCCATAACTTGGACCTTTCCCT
CCTTATTGCTCTTCACAGATGCAAGTGGTCGGATGCATAATCCTCCCTTTGCCTCGTGATCGCGGCATCC
GACCGACTTGGCGCTTGTTTTCTTTTTGGGGTCTCTTCATTAAACCCTTCAAGTGCGTAGCAGGAGTTAT
CTTCCTCTTGACGTGTACATCACATGGTATTCGAACGGCTCGTCGTCTGTAATGTACCTGGTGTCATGGT
TGTTCGGATAAGGTCGTCTCAAACTTGACACTGATGCACTTTTACCCCATTCATGGTGGGTCCCCCAGCT
ACCTATACGGTGGCAAATAGTGTTATGGTTGCCGGACATAATTTGTTATTTTTCCCTTTCTAGGAATTGT
TACCTAAACCTTCATTTTCATTCTTTTTTTTATCGTTTATTTTTATCTTGTAATTTTAACAAAACAAACA
ACAATTTTTATATGATACTAACCTAGATTTTCCAAACCATTCATCATTCGTTCATTAACACTTAACTTTC
CTCTACTTTCCACCCATTTTTAATCCAACAAATCAATAACCTTTATCATAACCTCCACAACCACTAACTT
AGCCAAATTACACAAAACAAACAAACCGATTAAAAACAATATAAAAATACACATCCTTTACACACCATCA
CACGCAACGCACACCAAAACTCAACACATCACACACCATAGCCCTACCTTTTACTTAAAATAAAAAACAA
GATAAAAATACAAAACATTTACGCCAATAATAAGCCCAAAATACTACATTTATCCGTCCATGTAGCTTAC
AGCAAAGCATGACACTGAAGATGTCAAGACGGCTGCCACAAACACCCATGGACAAGAGACTTAGTCCTAA
CCTTACTGTTGGTTTTTGCCAGAATTACACATGCAAGTATCCGCATTCCAGTGTAAATGCCCTAAGCACC
CTCTAACCAGGTCGATAGGAGCGGGTATCAGGCACACACAATTGTAGCCCAAGACGCCTTGCACTTGCCA
CACCCCCACGGGTACTCAGCAGTGATTAACATTAAGCAATGAGTGTAAACTTGACTTAGTCATGGCAACC
TTAAGGGTCGGTAAATCCTGTGCCAGCCACCGCGGTCATACAGGAGACTCAAATTAACAGTATAACGGCG
TAAAGGGTGGTAACATGCTATCTAAGTAACTAAGATTAAAAAGCAACTGAGCTGTAATAAGCCCAAGATG
CTCATAAGGCCAACTACCAAAGAAGATCTTAGGCTGACGATTAATTGAAATCCACGAAAGCCAGGGCCCA
AACTGGGATTAGATACCCCACTATGCCTGGCCCTAAATCTTGATGCTCTATGCTACCTGAGCATCCGCCC
GAGAACTACGAGCACAAACGCTTAAAACTCTAAGGACTTGGCGGTGTCCCAAACCCACCTAGAGGAGCCT
GTTCTGTAATCGATGATCCACGATATTACCTGACCACTCCTTGCTGAATCAGCCTACATACCGCCGTCGC
CAGCCCACCCCCCCTGATGGTTCAACAGTGAGCGCAATAGTCCAATACACTAGTAAGACAGGTCAAGGTA
TAGCCCATGGAGTGGAAGCAATGGGCTACATTTTCTAGATTAGAACATTACGGCAAAAGGGTCTGAAATG
GCCCTTAGAAGGCGGATTTAGCAGTAAAGTGGGACAATCGAGCCCTCTTTAAGCCGGCTCTGGGACACGT
ACATACCGCCCGTCACCCTCCTCACAAGCGACCCAAAACCCCCAATACATTAATACACTATCCAGCTAAA
GAGGAGGCAAGTCGTAACAAGGTAAGTGTACCGGAAGGTGCACTTAGACAACCAAGACGTAGCTTACATG
AAAGCATTCAGCTTACACCTGAAAAACATCTGATAACACCAGATCGTCTTGATGCCAAATTCTAGCCCAA
CCACATTGACCTGGAATAACAAAGCTACTGCATACACCAAACTAAAGCATTCATTAGTCTTAGTATAGGC
GATAGAAAAGACACCCATTGGCGCGATAGAGATCACGTACCGTAAGGGAAAGATGAAATAATAATGAAAA
AACTAAGCTATAAACAGCAAAGATCAACCCTTGTACCTTTTGCATCATGGTCTAGCAAGAAAAACCAAGC
AAAATGAGTTTAAGTTTGCCACCCCGAAACCTAAGCGAGCTACTTGTGAGCAGCTATTATTGAGCGAACC
CGTCTCTGTTGCAAAAGAGTGGGATGACTTACTAGTAGAGGTGAAAAGCCAATCGAGCTGGGTGATAGCT
GGTTGCCTGTGAAACGAATCTTAGTTCACTCTTAATTCTTCTCCAAGGAAACTAACAGAACCCTAATGAA
GCGAATTAAGGGCAATTTAAAGGGGGTACAGCTCCTTTAAAAAAGAATACAATCTCTACGAGCGGATAAA
TAATCTATAGAAAGATCTCCTGTGGGCCTTCAAGCAGCCATCAACAAAGAGTGCGTTAAAGCTCTTCGAC
TAAAAAATATAAGAACTTCATGACTCCCTCATCATTAACAGGCTAACCTATATGTAAATAGGAGAATTAA
TGCTAGAATGAGTAACCAGGGTCCTCCCTCTACGACGCAAGCTTACATCTTTACATTATTAACAAATCAC
CAAGATACGACAAATCAAACAAGCAGAGTATCAGGTAAATTGTTAACCCGACAGAGGAGCGTCCATTAAG
AAAGATTAAAACCTGTAAAAGGAACTAGGCAAACACATCAAGGCCCGACTGTTTACCAAAAACATAGCCT
TCAGCAAACAACAAACAAGTATTGAAGGTGATGCCTGCCCTGTGACTTAGTGTTTAACGGCCGCGGTATC
CTAACCGTGCAAAGGTAGCGCAATCAATTGTCTCATAAATCGGGACCAGTATGAATGGCTAAACGAGGTC
TTAACTGTCTCTTACAGGCGATCGGTGAAATTGATCTCCCTGTGCAAAAGCAGGGATAACTACATAAGAC
GAGAAGACCCTGTGGAGCTTAAAAATCAGCAGCCACCCCTTCACACATTCACACCCACTGGGTACACGCT
CATACAGGGAACTGGCCTGCATTTTTCGGTTGGGGCGACCTTGGAGAAAAACAAATCCTCCAAAAATTAG
ACCACAACTCTAGACTGAGAGCGACCCCTCAACGTGCGAATAGCACCCAGACCCAATATAATTGATCAAT
GGACCAAGTTACCCCAGGGATAACAGCGCAATCTCCTCCGAGAGTCCGTATCGACGGGGAGGTTTACGAC
CTCGATGTTGGATCAGGACATCCTAGTGGTGCAGCCGCTACTAAGGGTTCGTTTGTTCAACGATTAATAG
TCCTACGTGATCTGAGTTCAGACCGGAGCAATCCAGGTCGGTTTCCATCTATGATGAACTCTTCCCAGTA
CGAAAGGACAGGAAAAGTGAGGCCAATACTACAGGCAAGCCTTCGCCTTAAGTAATGAATCCAACTAAAT
TACGAAAGGCTATCACACTATAACTACGTCCTAGAAAAGGACCAGCTAGCGTGGCAGAGCTCGGAAAATG
CAAAAGGCTTAAGTCCTTTATATCAGAGGTTCAAATCCTCTCCCTAGCTAAACTTTAAAATGACCAACTA
TCCTATCCTAGTAAACCTCATTATAGCACTATCTTATGCCATCCCCATTCTAATCGCCGTAGCCTTTTTA
ACCCTAGTAGAGCGCAAAATCTTAAGCTACATGCAAGGCCGAAAAGGCCCCAATGTTGTAGGCCCCTTCG
GGCTACTACAACCCGTAGCAGATGGGGTAAAACTATTCATCAAAGAACCTATCCGCCCATCAACATCCTC
CCCAATCCTGTTTATTACTACCCCAATACTAGCCCTTCTCCTAGCAATCTCTATCTGAACCCCACTTCCA
ATCCCATTCCCCCTCGCAGACCTAAACCTAGGACTACTATTCATATTAGCTATATCAAGCCTAGCAGTAT
ACTCCATCCTATGATCTGGCTGAGCCTCCAACTCAAAATATGCCCTAATTGGATCTCTTCGAGCAGTAGC
CCAAACAATTTCATACGAGGTTACTCTAGCAATCATTCTACTATCCATTATCCTTCTTAGCGGAAATTAT
ACTCTAAGCACCCTAGCAGTTGTTCAAGAACCCCTATTTCTGATTTTCTCCTGCTGACCCCTAGCCATAA
TATGATATGTATCCACTCTGGCTGAAACAAATCGTGCCCCATTTGACCTCACGGAAGGAGAATCAGAACT
AGTCTCAGGATTCAACGTAGAATATGCTGCAGGACCATTCGCCCTATTCTTCCTAGCAGAATATGCAAAT
ATCATGCTCATAAACACACTAACCGTAATTCTGTTCCTAAACCCAAGCCTATACAACCCCCCTCAGGAGC
TCTTCCCTGTAATCCTGGCCACAAAGGTCCTGCTCCTCTCTATAGGATTCCTATGAATTCGTGCTTCCTA
CCCACGATTCCGATATGACCAACTAATGCATCTACTATGAAAAAACTTCCTCCCACTAACACTCGCCCTA
TGTCTATGGCACATTAGTATGCCAATTTCCTATGCAGGTCTACCTCCCTACCTAAGGAACCACCAGGAAA
TGTGCCTGAACATCAAAAGGGTCACTATGATAAAGTGAACATAGAGGTATACCAGCCCTCTCATTTCCTA
CATATTAGAAAAACAGGAATCGAACCTGTACAAGAGAGATCAAAACCCTCCATACTTCCTTTATATTATT
TTCTAGTAGGGTCAGCTAATCAAGCTATCGGGCCCATACCCCGAAAATGATGGTTTAACCCCTTCCCCTG
CTAATGAACCCCCAAGCAAAACTAATTTTTGTTACTAGCCTACTCCTAGGAACAACCATCACAATTTCAA
GCAACCATTGAATTATGGCCTGAACCGGCCTTGAAATCAACACACTCGCTATCTTACCCCTGATTTCAAA
ATCTCACCACCCCCGAGCCATTGAGGCAGCAACTAAATACTTTCTAGTTCAAGCAACTGCCTCAACCCTA
GTACTATTCTCCAGCATAACTAATGCATGGTACACAGGACAGTGGGATATTACCCAACTAACCCATCCAA
CATCCTCCCTAATCCTAACTGCAGCCATTTCAATGAAGCTAGGACTAGTGCCCTTCCACTTTTGATTCCC
AGAAGTCCTACAAGGCTCCCCCATCATTACAGGCCTTCTCCTATCCACAGTCATAAAATTCCCACCAATT
ACCCTACTCTACATAACTTCCCTATCCCTAAATCCTACACTACTGACTACCCTAGCTATTCTTTCCGTGG
CCCTAGGAGGCTGAATAGGACTGAACCAAACACAAACCCGAAAAATCATGGCCTTCTCCTCTATCTCGCA
CCTAGGCTGAATGGCCATTATCCTGATCTACTACCCTAAACTGACTCTTCTCAACTTCTACCTATATGCC
ATAATAACCGCTGCCGTATTCCTAACCCTAAACTCAATAAAAGTCCTAAATCTATCTACACTGATAACTG
CATGAACAAAAGCACCTTCACTTAGCACAATTCTCCTACTAACACTCCTATCCCTAGCCGGCCTCCCCCC
TCTAACTGGCTTCCTCCCAAAATGACTCATTATTCAAGAGCTAACCAAACAAGACATGGCCCCAGCAGCA
ATCATTATCTCCCTTCTATCACTGCTGGGCCTCTTCTTCTATCTTCGCCTTGCATATTGTGCAACAATCA
CACTCCCACCCCACACAACAAACCACATGAAACAGTGGCATACCAACAAACCAATCAATCCCTCAATCGC
TGTTCTAACCACCCTGTCCATCATGCTCCTCCCAATTTCTCCCATACTTACTACCATTATCTAAAGAGAA
ACTTAGGTTTACTGAAACCGAAGGCCTTCAAAGCCTTAAACAAGAGTTAGACCCTCTTAGTTTCTGTTAA
AATCCGCAGGGCGTTATCCTGCATCTTCTGAATGCAACTCAGATGCTTTAATTAAGCTAGGATTTTACAC
CCCTAGACAGATGGGCTTCGATCCCATGATACTATAGTTAACAGCTATATGCCCCAAACCAACAGGCTTC
TGCCTAATAGGCCCCGGTGCACTATCAATGCACATCAATGAGCTTGCAACTCACCATGAACTTCACTACA
GAGCCGATAAGAAGAGGAATTGAACCTCTGTAAAAAGGACTACAGCCTAACGCTTATACACTCAGCCATC
TTACCCGTGACTTTCATCAACCGATGACTATTCTCAACCAACCACAAAGACATTGGCACTCTGTACCTAA
TCTTCGGAGCGTGAGCCGGAATAGTAGGTACCGCCCTAAGCCTCCTCATCCGAGCAGAACTAGGCCAACC
AGGCGCTCTGCTAGGAGACGACCAAATCTATAATGTAATCGTCACAGCCCACGCTTTCGTCATAATTTTC
TTTATAGTGATGCCTATCATAATCGGAGGATTTGGAAACTGACTAGTCCCTCTAATGATCGGCGCCCCGG
ACATAGCATTCCCACGAATAAACAATATAAGCTTCTGACTCCTCCCACCCTCATTCCTTCTCCTTCTAGC
CTCTTCCACAGTAGAAGCAGGAGCAGGAACAGGATGAACTGTGTACCCACCACTAGCCGGCAACCTAGCC
CACGCTGGAGCCTCAGTCGACCTAGCCATCTTCTCACTACACCTAGCAGGTATTTCCTCCATCCTAGGGG
CAATTAACTTCATCACTACAGCAATTAACATAAAACCCCCAGCCCTATCACAATACCAAACCCCTCTATT
CGTATGATCTGTACTAATTACCGCAGTACTACTCCTTCTCTCCCTACCTGTACTTGCTGCCGGAATTACT
ATGCTCCTAACAGACCGTAACCTCAACACCACATTCTTCGATCCAGCAGGAGGAGGAGACCCAGTACTAT
ACCAACATCTATTCTGATTCTTTGGACACCCAGAAGTTTATATCCTAATTCTACCAGGATTCGGTATCAT
CTCCCACGTCGTAGCATACTACGCAGGAAAAAAAGAACCATTTGGCTACATAGGAATAGTATGAGCTATG
CTATCCATCGGATTCCTAGGCTTCATTGTCTGAGCACACCACATGTTTACAGTCGGAATGGATGTAGACA
CTCGAGCATACTTCACATCCGCCACCATAATCATTGCTATCCCAACCGGAATCAAAGTGTTCAGCTGACT
AGCAACCCTTCACGGAGGGACAATCAAATGAGACCCACCAATGCTATGAGCCCTAGGGTTCATCTTCCTC
TTCACTATTGGTGGACTGACAGGAATTGTCCTAGCAAACTCCTCCCTAGACATTGCCCTACACGACACTT
ATTACGTAGTAGCTCACTTCCACTACGTTCTATCCATAGGAGCAGTATTCGCAATCCTAGCAGGATTTAC
CCACTGATTCCCACTATTCACCGGATATACCCTACACTCTACATGAGCTAAAATCCACTTCGGAGTAATA
TTCGTAGGAGTAAATCTTACTTTCTTCCCACAACACTTCCTTGGACTAGCTGGTATGCCACGACGATACT
CAGACTACCCAGACGCCTACACCCTATGAAACACTATCTCATCAGTAGGCTCACTAATCTCCCTAACTGC
CGTAATCATGCTAATATTCATCATCTGAGAAGCTTTCGCATCCAAACGTAAAGCCCTACAACCAGAACTA
GTCAATACAAACGTCGAATGAATCCACGGCTGCCCACCACCATTCCACACATTTGAAGAACCAGCCTTCG
TTCAAGTTCAAGAAAGGAAGGAGTCGAACCCTCATATGTTGGTTTCAAGCCAACCGCATAAACCACTTAT
GCTTCTTTCTCATTTAGAGGTGTTAGTAAAACTATTACATAGTCTTGTCAAGACTAAATTACAGGTGAAA
GCCCAGTACACCTCAAACACAAATATGGCCAACCACATACAATTCGGTTTTCAAGACGCTTCATCCCCTA
TCATAGAAGAACTAGTAGAATTCCACGACCACGCCCTAATAACTGCCCTAGCTATTTGCAGCCTGGTACT
ATATCTACTAACCATAATACTCACTGAAAAACTATCATCCAGCACAGTCGATGCACAAGAGATCGAACTT
GTCTGAACTATCCTTCCTGCAATCGTCCTAATCATGCTTGCTCTACCATCCCTACAAATCCTCTACATAA
TGGATGAAATCAACGAGCCAGACCTGACACTAAAAGCCATTGGACACCAATGGTACTGAACCTATGAATA
CACCGACTTCAAGGACCTAACATTTGACTCTTACATGACACCAACTGCAGACCTACCACTAGGCCACTTC
CGACTACTAGAAGTGGACCATCGTGTAGTCGTCCCAATGGAATCACTAGTCCGAGTCATCGTTACTGCCG
ACGACGTACTTCACTCATGAGCCGTCCCAAGCCTAGGCGTAAAAACTGACGCAATCCCAGGACGACTAAA
TCAAACTTCATTCACCGCCACCCGACCTGGAGTATTCTACGGCCAATGCTCAGAAATCTGCGGGGCTAAC
CACAGCTTCATACCAATTGTAGTTGAATCTGCCCCACTCGCTAACTTCGAAAGCTGATCCTCTCTACTAT
CATCCTAATCATTAAGAAGCTATGTACCAGCACTAGCCTTTTAAGCTAGAGAAAGAGGACTATTAATCCT
CCTTAATGATATGCCTCAACTAAACCCAAATCCATGATTTTTTATCATGCTAACTTCGTGACTCACCTAC
TCCATAATCATCCAGCCTAAACTACTATCCTTCATTTCCATAAACCCTCCACTCAACAAAGCCCAAACAA
CCAAAACTACCACCCCCTGAACCTGACCATGAACCTAAGCTTCTTCAACCAATTCTCAAGTCCATCCCTA
CTGGGTATCCCCCTAATCCTAATTGCAATAACATTCCCTGCTCTCCTACTACCAACCCAAAATAACCGAT
GAATCACTGATCGCCTATCCACCCTACAATCATGATTCATTAGCCTAGTCACAAAACAACTGATAATACC
ACTAAGCAACAAAGGACATAAATGAGCCTTAATCCTAACATCTCTAATAATCTTCCTATTACTCATCAAC
CTTCTAGGCCTACTACCCTACACATTCACTCCAACAACTCAACTCTCCATAAACCTAGCCCTAGCAATCC
CTCTATGGCTTGCCACTTTACTTACAGGGCTACGAAACCAACCCTCAGTCTCCCTAGGACACCTCCTACC
AGAAGGTACCCCAACCCCATTAATCCCAGCCCTAATCCTCATCGAAACAACTAGCCTTCTTATTCGTCCC
CTAGCCCTAGGTGTACGTCTCACAGCCAATCTCACAGCAGGTCACCTACTAATCCAACTCATCTCAACAG
CCACTGCCGCCCTAATCTCAACAATACCAATAGTCTCACTACTAACACTATTAGTCCTATTCCTACTTAC
AATCCTAGAAGTGGCAGTAGCCATAATCCAAGCTTACGTATTTGTGCTACTACTAAGCCTATACCTACAA
GAAAACATTTAAATCACCAATGACTCACCAAGCACACTCTTACCACATAGTTGACCCTAGCCCATGACCC
ATTCTA


Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.