Viewing data for Rusa unicolor


Scientific name Rusa unicolor
Common name Sambar
Maximum lifespan 26.40 years (Rusa unicolor@AnAge)

Total mtDNA (size: 16505 bases) GC AT G C A T
Base content (bases) 6194 10311 3973 2221 4780 5531
Base content per 1 kb (bases) 375 625 241 135 290 335
Base content (%) 37.5% 62.5%
Total protein-coding genes (size: 11318 bases) GC AT G C A T
Base content (bases) 4261 7057 2905 1356 3377 3680
Base content per 1 kb (bases) 376 624 257 120 298 325
Base content (%) 37.6% 62.4%
D-loop (size: 1081 bases) GC AT G C A T
Base content (bases) 390 691 224 166 348 343
Base content per 1 kb (bases) 361 639 207 154 322 317
Base content (%) 36.1% 63.9%
Total tRNA-coding genes (size: 1513 bases) GC AT G C A T
Base content (bases) 552 961 306 246 428 533
Base content per 1 kb (bases) 365 635 202 163 283 352
Base content (%) 36.5% 63.5%
Total rRNA-coding genes (size: 2536 bases) GC AT G C A T
Base content (bases) 969 1567 527 442 615 952
Base content per 1 kb (bases) 382 618 208 174 243 375
Base content (%) 38.2% 61.8%
12S rRNA gene (size: 955 bases) GC AT G C A T
Base content (bases) 391 564 222 169 213 351
Base content per 1 kb (bases) 409 591 232 177 223 368
Base content (%) 40.9% 59.1%
16S rRNA gene (size: 1581 bases) GC AT G C A T
Base content (bases) 578 1003 305 273 402 601
Base content per 1 kb (bases) 366 634 193 173 254 380
Base content (%) 36.6% 63.4%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 256 425 177 79 211 214
Base content per 1 kb (bases) 376 624 260 116 310 314
Base content (%) 37.6% 62.4%
ATP8 (size: 201 bases) GC AT G C A T
Base content (bases) 53 148 39 14 64 84
Base content per 1 kb (bases) 264 736 194 70 318 418
Base content (%) 26.4% 73.6%
COX1 (size: 1543 bases) GC AT G C A T
Base content (bases) 599 944 350 249 497 447
Base content per 1 kb (bases) 388 612 227 161 322 290
Base content (%) 38.8% 61.2%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 251 433 158 93 191 242
Base content per 1 kb (bases) 367 633 231 136 279 354
Base content (%) 36.7% 63.3%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 330 454 217 113 237 217
Base content per 1 kb (bases) 421 579 277 144 302 277
Base content (%) 42.1% 57.9%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 457 683 309 148 327 356
Base content per 1 kb (bases) 401 599 271 130 287 312
Base content (%) 40.1% 59.9%
ND1 (size: 955 bases) GC AT G C A T
Base content (bases) 372 583 257 115 284 299
Base content per 1 kb (bases) 390 610 269 120 297 313
Base content (%) 39.0% 61.0%
ND2 (size: 1042 bases) GC AT G C A T
Base content (bases) 353 689 263 90 301 388
Base content per 1 kb (bases) 339 661 252 86 289 372
Base content (%) 33.9% 66.1%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 131 215 89 42 108 107
Base content per 1 kb (bases) 379 621 257 121 312 309
Base content (%) 37.9% 62.1%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 508 870 359 149 431 439
Base content per 1 kb (bases) 369 631 261 108 313 319
Base content (%) 36.9% 63.1%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 107 190 69 38 97 93
Base content per 1 kb (bases) 360 640 232 128 327 313
Base content (%) 36.0% 64.0%
ND5 (size: 1791 bases) GC AT G C A T
Base content (bases) 664 1127 475 189 527 600
Base content per 1 kb (bases) 371 629 265 106 294 335
Base content (%) 37.1% 62.9%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 194 334 152 42 121 213
Base content per 1 kb (bases) 367 633 288 80 229 403
Base content (%) 36.7% 63.3%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (5.31%)
Alanine (Ala, A)
n = 20 (8.85%)
Serine (Ser, S)
n = 14 (6.19%)
Threonine (Thr, T)
n = 21 (9.29%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 11 (4.87%)
Leucine (Leu, L)
n = 44 (19.47%)
Isoleucine (Ile, I)
n = 23 (10.18%)
Methionine (Met, M)
n = 14 (6.19%)
Proline (Pro, P)
n = 12 (5.31%)
Phenylalanine (Phe, F)
n = 12 (5.31%)
Tyrosine (Tyr, Y)
n = 2 (0.88%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 11 (4.87%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 6 (2.65%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 4 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 9 12 13 4 18 1 7 8 1 4 1 6 0 11 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 5 9 6 0 1 3 7 1 2 2 8 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 12 0 2 2 5 0 3 2 0 2 1 1 9 2 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 2 1 0 1 4 0 1 2 1 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
47 67 78 35
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
24 62 37 104
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 48 99 72
ATP8 (size: 201 bases)
Amino acid sequence: MPQLDTSTWLMMIMSMFLALFIIFQLKISKHNFHFNPELTLTKTQKQDNHWETKWTKIYLPLLLPQ*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 1 (1.52%)
Serine (Ser, S)
n = 3 (4.55%)
Threonine (Thr, T)
n = 7 (10.61%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 11 (16.67%)
Isoleucine (Ile, I)
n = 5 (7.58%)
Methionine (Met, M)
n = 5 (7.58%)
Proline (Pro, P)
n = 4 (6.06%)
Phenylalanine (Phe, F)
n = 5 (7.58%)
Tyrosine (Tyr, Y)
n = 1 (1.52%)
Tryptophan (Trp, W)
n = 3 (4.55%)
Aspartic acid (Asp, D)
n = 2 (3.03%)
Glutamic acid (Glu, E)
n = 2 (3.03%)
Asparagine (Asn, N)
n = 3 (4.55%)
Glutamine (Gln, Q)
n = 5 (7.58%)
Histidine (His, H)
n = 3 (4.55%)
Lysine (Lys, K)
n = 6 (9.09%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 0 3 2 0 4 0 3 5 0 0 0 0 0 4 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 1 0 0 0 0 0 0 0 1 1 2 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 5 1 0 1 1 1 0 0 1 0 0 2 2 1 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 2 0 6 0 0 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
5 18 26 18
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
3 15 23 26
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 6 35 20
COX1 (size: 1543 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.16%)
Alanine (Ala, A)
n = 39 (7.6%)
Serine (Ser, S)
n = 31 (6.04%)
Threonine (Thr, T)
n = 38 (7.41%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 38 (7.41%)
Leucine (Leu, L)
n = 59 (11.5%)
Isoleucine (Ile, I)
n = 38 (7.41%)
Methionine (Met, M)
n = 33 (6.43%)
Proline (Pro, P)
n = 28 (5.46%)
Phenylalanine (Phe, F)
n = 42 (8.19%)
Tyrosine (Tyr, Y)
n = 19 (3.7%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 15 (2.92%)
Glutamic acid (Glu, E)
n = 10 (1.95%)
Asparagine (Asn, N)
n = 19 (3.7%)
Glutamine (Gln, Q)
n = 6 (1.17%)
Histidine (His, H)
n = 17 (3.31%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
27 11 29 7 7 19 4 19 6 0 11 7 20 0 29 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 12 11 14 2 9 12 18 8 10 6 11 1 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 22 0 9 4 15 0 1 2 12 7 1 3 10 9 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 9 1 6 9 9 0 1 2 5 0 0 0 0 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
149 96 140 129
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 133 95 210
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 121 212 157
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 8 (3.52%)
Serine (Ser, S)
n = 21 (9.25%)
Threonine (Thr, T)
n = 18 (7.93%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 12 (5.29%)
Leucine (Leu, L)
n = 34 (14.98%)
Isoleucine (Ile, I)
n = 17 (7.49%)
Methionine (Met, M)
n = 17 (7.49%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 6 (2.64%)
Tyrosine (Tyr, Y)
n = 11 (4.85%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 10 (4.41%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 6 (2.64%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 7 (3.08%)
Lysine (Lys, K)
n = 5 (2.2%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 7 13 2 3 19 2 7 6 0 4 2 6 0 2 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 2 4 1 3 0 1 2 5 0 2 2 9 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 12 2 7 2 5 2 0 5 8 3 0 1 4 2 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 13 2 4 6 5 0 0 1 4 1 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
53 58 68 49
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 55 61 86
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 45 113 56
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 15 (5.77%)
Serine (Ser, S)
n = 20 (7.69%)
Threonine (Thr, T)
n = 23 (8.85%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 15 (5.77%)
Leucine (Leu, L)
n = 32 (12.31%)
Isoleucine (Ile, I)
n = 16 (6.15%)
Methionine (Met, M)
n = 10 (3.85%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 7 (2.69%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 7 9 5 4 12 1 10 7 0 3 7 5 0 11 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 2 4 8 3 0 1 8 8 3 1 5 5 1 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 10 0 4 3 8 0 3 2 7 4 1 0 2 5 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 7 1 0 3 2 0 0 3 2 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
61 63 63 74
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 65 55 97
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 89 99 65
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.33%)
Alanine (Ala, A)
n = 23 (6.07%)
Serine (Ser, S)
n = 22 (5.8%)
Threonine (Thr, T)
n = 26 (6.86%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 19 (5.01%)
Leucine (Leu, L)
n = 54 (14.25%)
Isoleucine (Ile, I)
n = 42 (11.08%)
Methionine (Met, M)
n = 16 (4.22%)
Proline (Pro, P)
n = 23 (6.07%)
Phenylalanine (Phe, F)
n = 30 (7.92%)
Tyrosine (Tyr, Y)
n = 15 (3.96%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 18 (4.75%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 11 (2.9%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 25 13 6 11 22 3 12 6 0 4 6 9 0 12 18
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 2 2 4 16 1 1 6 15 2 5 3 14 1 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 16 0 3 6 10 0 0 3 7 8 0 0 6 12 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 4 2 5 6 8 1 0 1 7 0 1 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
83 90 115 92
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 91 76 161
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 128 165 74
ND1 (size: 955 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.79%)
Alanine (Ala, A)
n = 28 (8.83%)
Serine (Ser, S)
n = 23 (7.26%)
Threonine (Thr, T)
n = 17 (5.36%)
Cysteine (Cys, C)
n = 1 (0.32%)
Valine (Val, V)
n = 15 (4.73%)
Leucine (Leu, L)
n = 54 (17.03%)
Isoleucine (Ile, I)
n = 32 (10.09%)
Methionine (Met, M)
n = 20 (6.31%)
Proline (Pro, P)
n = 22 (6.94%)
Phenylalanine (Phe, F)
n = 22 (6.94%)
Tyrosine (Tyr, Y)
n = 11 (3.47%)
Tryptophan (Trp, W)
n = 9 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.95%)
Glutamic acid (Glu, E)
n = 11 (3.47%)
Asparagine (Asn, N)
n = 13 (4.1%)
Glutamine (Gln, Q)
n = 7 (2.21%)
Histidine (His, H)
n = 3 (0.95%)
Lysine (Lys, K)
n = 7 (2.21%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 14 15 5 7 32 1 9 7 0 3 3 9 0 13 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 1 0 12 16 0 2 4 2 4 4 9 8 1 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 14 0 4 7 8 1 1 2 9 2 0 0 6 7 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 11 0 2 1 7 0 0 2 5 1 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 85 92 72
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 87 55 143
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 85 152 68
ND2 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 17 (4.91%)
Serine (Ser, S)
n = 27 (7.8%)
Threonine (Thr, T)
n = 38 (10.98%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 14 (4.05%)
Leucine (Leu, L)
n = 52 (15.03%)
Isoleucine (Ile, I)
n = 34 (9.83%)
Methionine (Met, M)
n = 46 (13.29%)
Proline (Pro, P)
n = 20 (5.78%)
Phenylalanine (Phe, F)
n = 14 (4.05%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 15 (4.34%)
Glutamine (Gln, Q)
n = 10 (2.89%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 13 (3.76%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 11 39 6 8 31 0 6 10 0 6 4 4 0 9 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 0 2 6 9 0 0 6 8 0 3 6 11 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 19 0 3 7 15 0 0 2 4 4 0 1 6 9 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 4 1 2 0 13 0 0 0 3 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
52 83 148 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 100 58 160
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 80 182 76
ND3 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 17 (4.91%)
Serine (Ser, S)
n = 27 (7.8%)
Threonine (Thr, T)
n = 38 (10.98%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 14 (4.05%)
Leucine (Leu, L)
n = 52 (15.03%)
Isoleucine (Ile, I)
n = 34 (9.83%)
Methionine (Met, M)
n = 46 (13.29%)
Proline (Pro, P)
n = 20 (5.78%)
Phenylalanine (Phe, F)
n = 14 (4.05%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 15 (4.34%)
Glutamine (Gln, Q)
n = 10 (2.89%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 13 (3.76%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 11 39 6 8 31 0 6 10 0 6 4 4 0 9 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 0 2 6 9 0 0 6 8 0 3 6 11 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 19 0 3 7 15 0 0 2 4 4 0 1 6 9 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 4 1 2 0 13 0 0 0 3 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
52 83 148 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 100 58 160
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 80 182 76
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.93%)
Alanine (Ala, A)
n = 26 (5.68%)
Serine (Ser, S)
n = 40 (8.73%)
Threonine (Thr, T)
n = 33 (7.21%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 19 (4.15%)
Leucine (Leu, L)
n = 92 (20.09%)
Isoleucine (Ile, I)
n = 38 (8.3%)
Methionine (Met, M)
n = 33 (7.21%)
Proline (Pro, P)
n = 22 (4.8%)
Phenylalanine (Phe, F)
n = 24 (5.24%)
Tyrosine (Tyr, Y)
n = 17 (3.71%)
Tryptophan (Trp, W)
n = 13 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 9 (1.97%)
Asparagine (Asn, N)
n = 24 (5.24%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 10 (2.18%)
Lysine (Lys, K)
n = 14 (3.06%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
29 9 28 15 16 32 2 26 8 3 3 5 11 0 14 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 3 7 9 10 0 2 8 7 1 5 9 7 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 18 0 5 11 11 2 3 8 11 6 0 1 10 14 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 8 1 0 3 12 2 0 2 7 1 0 0 0 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
75 118 153 113
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
55 110 88 206
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 131 198 111
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 9 (9.18%)
Serine (Ser, S)
n = 10 (10.2%)
Threonine (Thr, T)
n = 5 (5.1%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 7 (7.14%)
Leucine (Leu, L)
n = 22 (22.45%)
Isoleucine (Ile, I)
n = 4 (4.08%)
Methionine (Met, M)
n = 11 (11.22%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 4 (4.08%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 5 (5.1%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 1 (1.02%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 1 8 3 2 12 0 5 2 0 2 1 3 1 1 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 3 0 3 5 1 0 1 2 1 0 1 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 3 0 4 2 3 0 0 1 4 0 0 0 4 1 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 0 1 1 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
23 23 27 26
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 24 18 48
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 22 48 23
ND5 (size: 1791 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 29 (4.87%)
Alanine (Ala, A)
n = 40 (6.71%)
Serine (Ser, S)
n = 44 (7.38%)
Threonine (Thr, T)
n = 58 (9.73%)
Cysteine (Cys, C)
n = 5 (0.84%)
Valine (Val, V)
n = 15 (2.52%)
Leucine (Leu, L)
n = 84 (14.09%)
Isoleucine (Ile, I)
n = 61 (10.23%)
Methionine (Met, M)
n = 41 (6.88%)
Proline (Pro, P)
n = 26 (4.36%)
Phenylalanine (Phe, F)
n = 47 (7.89%)
Tyrosine (Tyr, Y)
n = 18 (3.02%)
Tryptophan (Trp, W)
n = 12 (2.01%)
Aspartic acid (Asp, D)
n = 12 (2.01%)
Glutamic acid (Glu, E)
n = 10 (1.68%)
Asparagine (Asn, N)
n = 36 (6.04%)
Glutamine (Gln, Q)
n = 19 (3.19%)
Histidine (His, H)
n = 10 (1.68%)
Lysine (Lys, K)
n = 21 (3.52%)
Arginine (Arg, R)
n = 8 (1.34%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
29 32 38 10 14 36 7 17 18 1 2 5 8 0 25 22
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 3 5 16 19 0 5 10 12 2 6 11 9 0 15
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 32 2 8 13 11 1 5 6 10 8 1 0 15 21 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 10 0 2 10 20 1 3 2 3 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
106 130 228 133
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
65 157 127 248
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 188 245 146
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (14.86%)
Alanine (Ala, A)
n = 6 (3.43%)
Serine (Ser, S)
n = 11 (6.29%)
Threonine (Thr, T)
n = 10 (5.71%)
Cysteine (Cys, C)
n = 1 (0.57%)
Valine (Val, V)
n = 23 (13.14%)
Leucine (Leu, L)
n = 18 (10.29%)
Isoleucine (Ile, I)
n = 15 (8.57%)
Methionine (Met, M)
n = 12 (6.86%)
Proline (Pro, P)
n = 3 (1.71%)
Phenylalanine (Phe, F)
n = 13 (7.43%)
Tyrosine (Tyr, Y)
n = 10 (5.71%)
Tryptophan (Trp, W)
n = 4 (2.29%)
Aspartic acid (Asp, D)
n = 4 (2.29%)
Glutamic acid (Glu, E)
n = 9 (5.14%)
Asparagine (Asn, N)
n = 4 (2.29%)
Glutamine (Gln, Q)
n = 2 (1.14%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 3 (1.71%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 2 6 2 0 0 2 10 1 1 8 0 5 10 12 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 0 3 0 3 0 10 0 9 7 3 0 0 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 3 2 4 1 0 2 4 0 8 2 4 4 4 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 8 4 0 1 2 1 0 0 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 10 48 50
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 26 33 81
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
48 6 40 82
Total protein-coding genes (size: 11370 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 218 (5.76%)
Alanine (Ala, A)
n = 243 (6.42%)
Serine (Ser, S)
n = 273 (7.21%)
Threonine (Thr, T)
n = 303 (8.0%)
Cysteine (Cys, C)
n = 23 (0.61%)
Valine (Val, V)
n = 191 (5.04%)
Leucine (Leu, L)
n = 583 (15.39%)
Isoleucine (Ile, I)
n = 330 (8.71%)
Methionine (Met, M)
n = 264 (6.97%)
Proline (Pro, P)
n = 192 (5.07%)
Phenylalanine (Phe, F)
n = 252 (6.65%)
Tyrosine (Tyr, Y)
n = 130 (3.43%)
Tryptophan (Trp, W)
n = 104 (2.75%)
Aspartic acid (Asp, D)
n = 69 (1.82%)
Glutamic acid (Glu, E)
n = 96 (2.53%)
Asparagine (Asn, N)
n = 166 (4.38%)
Glutamine (Gln, Q)
n = 93 (2.46%)
Histidine (His, H)
n = 91 (2.4%)
Lysine (Lys, K)
n = 97 (2.56%)
Arginine (Arg, R)
n = 63 (1.66%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
201 129 218 83 78 247 23 138 87 6 51 41 88 11 148 104
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
46 6 17 46 86 107 4 33 60 96 29 43 57 87 5 61
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
64 171 7 53 61 95 9 22 33 81 49 9 14 79 87 37
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
54 79 17 27 42 90 7 6 16 38 3 1 0 6 0 95
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
817 870 1216 885
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
464 956 748 1620
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
190 978 1643 977

Failed to understand id: ?term=("Rusa unicolor"[Organism]) AND (refseq[filter] AND mitochondrion[filter])


Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.