| Scientific name | Hippotragus niger |
| Common name | Sable antelope |
| Maximum lifespan | 22.20 years (Hippotragus niger@AnAge) |
| Total mtDNA (size: 16507 bases) | GC | AT | G | C | A | T |
|---|---|---|---|---|---|---|
| Base content (bases) | 6614 | 9892 | 4377 | 2237 | 4392 | 5500 |
| Base content per 1 kb (bases) | 401 | 599 | 265 | 136 | 266 | 333 |
| Base content (%) | 40.1% | 59.9% | ||||
| Total protein-coding genes (size: 11338 bases) | GC | AT | G | C | A | T |
|---|---|---|---|---|---|---|
| Base content (bases) | 4567 | 6770 | 3200 | 1367 | 3095 | 3675 |
| Base content per 1 kb (bases) | 403 | 597 | 282 | 121 | 273 | 324 |
| Base content (%) | 40.3% | 59.7% | ||||
| Total tRNA-coding genes (size: 1506 bases) | GC | AT | G | C | A | T |
|---|---|---|---|---|---|---|
| Base content (bases) | 553 | 953 | 321 | 232 | 417 | 536 |
| Base content per 1 kb (bases) | 367 | 633 | 213 | 154 | 277 | 356 |
| Base content (%) | 36.7% | 63.3% | ||||
| Total rRNA-coding genes (size: 2524 bases) | GC | AT | G | C | A | T |
|---|---|---|---|---|---|---|
| Base content (bases) | 1024 | 1500 | 567 | 457 | 577 | 923 |
| Base content per 1 kb (bases) | 406 | 594 | 225 | 181 | 229 | 366 |
| Base content (%) | 40.6% | 59.4% | ||||
| 12S rRNA gene (size: 954 bases) | GC | AT | G | C | A | T |
|---|---|---|---|---|---|---|
| Base content (bases) | 398 | 556 | 224 | 174 | 209 | 347 |
| Base content per 1 kb (bases) | 417 | 583 | 235 | 182 | 219 | 364 |
| Base content (%) | 41.7% | 58.3% | ||||
| 16S rRNA gene (size: 1570 bases) | GC | AT | G | C | A | T |
|---|---|---|---|---|---|---|
| Base content (bases) | 626 | 944 | 343 | 283 | 368 | 576 |
| Base content per 1 kb (bases) | 399 | 601 | 218 | 180 | 234 | 367 |
| Base content (%) | 39.9% | 60.1% | ||||
| ATP6 (size: 681 bases) | GC | AT | G | C | A | T |
|---|---|---|---|---|---|---|
| Base content (bases) | 263 | 418 | 188 | 75 | 201 | 217 |
| Base content per 1 kb (bases) | 386 | 614 | 276 | 110 | 295 | 319 |
| Base content (%) | 38.6% | 61.4% | ||||
| ATP8 (size: 201 bases) | GC | AT | G | C | A | T |
|---|---|---|---|---|---|---|
| Base content (bases) | 68 | 133 | 53 | 15 | 52 | 81 |
| Base content per 1 kb (bases) | 338 | 662 | 264 | 75 | 259 | 403 |
| Base content (%) | 33.8% | 66.2% | ||||
| COX1 (size: 1545 bases) | GC | AT | G | C | A | T |
|---|---|---|---|---|---|---|
| Base content (bases) | 652 | 893 | 394 | 258 | 449 | 444 |
| Base content per 1 kb (bases) | 422 | 578 | 255 | 167 | 291 | 287 |
| Base content (%) | 42.2% | 57.8% | ||||
| COX2 (size: 684 bases) | GC | AT | G | C | A | T |
|---|---|---|---|---|---|---|
| Base content (bases) | 264 | 420 | 164 | 100 | 180 | 240 |
| Base content per 1 kb (bases) | 386 | 614 | 240 | 146 | 263 | 351 |
| Base content (%) | 38.6% | 61.4% | ||||
| COX3 (size: 784 bases) | GC | AT | G | C | A | T |
|---|---|---|---|---|---|---|
| Base content (bases) | 345 | 439 | 230 | 115 | 226 | 213 |
| Base content per 1 kb (bases) | 440 | 560 | 293 | 147 | 288 | 272 |
| Base content (%) | 44.0% | 56.0% | ||||
| CYTB (size: 1140 bases) | GC | AT | G | C | A | T |
|---|---|---|---|---|---|---|
| Base content (bases) | 483 | 656 | 331 | 152 | 303 | 353 |
| Base content per 1 kb (bases) | 424 | 575 | 290 | 133 | 266 | 310 |
| Base content (%) | 42.4% | 57.5% | ||||
| ND1 (size: 956 bases) | GC | AT | G | C | A | T |
|---|---|---|---|---|---|---|
| Base content (bases) | 403 | 553 | 286 | 117 | 256 | 297 |
| Base content per 1 kb (bases) | 422 | 578 | 299 | 122 | 268 | 311 |
| Base content (%) | 42.2% | 57.8% | ||||
| ND2 (size: 1042 bases) | GC | AT | G | C | A | T |
|---|---|---|---|---|---|---|
| Base content (bases) | 387 | 655 | 297 | 90 | 273 | 382 |
| Base content per 1 kb (bases) | 371 | 629 | 285 | 86 | 262 | 367 |
| Base content (%) | 37.1% | 62.9% | ||||
| ND3 (size: 346 bases) | GC | AT | G | C | A | T |
|---|---|---|---|---|---|---|
| Base content (bases) | 149 | 197 | 106 | 43 | 93 | 104 |
| Base content per 1 kb (bases) | 431 | 569 | 306 | 124 | 269 | 301 |
| Base content (%) | 43.1% | 56.9% | ||||
| ND4 (size: 1378 bases) | GC | AT | G | C | A | T |
|---|---|---|---|---|---|---|
| Base content (bases) | 543 | 835 | 394 | 149 | 395 | 440 |
| Base content per 1 kb (bases) | 394 | 606 | 286 | 108 | 287 | 319 |
| Base content (%) | 39.4% | 60.6% | ||||
| ND4L (size: 297 bases) | GC | AT | G | C | A | T |
|---|---|---|---|---|---|---|
| Base content (bases) | 117 | 180 | 79 | 38 | 88 | 92 |
| Base content per 1 kb (bases) | 394 | 606 | 266 | 128 | 296 | 310 |
| Base content (%) | 39.4% | 60.6% | ||||
| ND5 (size: 1821 bases) | GC | AT | G | C | A | T |
|---|---|---|---|---|---|---|
| Base content (bases) | 721 | 1100 | 537 | 184 | 488 | 612 |
| Base content per 1 kb (bases) | 396 | 604 | 295 | 101 | 268 | 336 |
| Base content (%) | 39.6% | 60.4% | ||||
| ND6 (size: 528 bases) | GC | AT | G | C | A | T |
|---|---|---|---|---|---|---|
| Base content (bases) | 192 | 336 | 155 | 37 | 113 | 223 |
| Base content per 1 kb (bases) | 364 | 636 | 294 | 70 | 214 | 422 |
| Base content (%) | 36.4% | 63.6% | ||||
| ATP6 (size: 681 bases) | |||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Amino acid sequence: | |||||||||||||||
| Amino acid frequencies: |
|||||||||||||||
| Codon statistics: | |||||||||||||||
| AUU | AUC | AUA | CUU | CUC | CUA | CUG | UUA | CAA | CAG | GUU | GUC | GUA | GUG | UUU | UUC |
| 19 | 7 | 8 | 5 | 8 | 19 | 3 | 9 | 9 | 0 | 1 | 2 | 6 | 0 | 9 | 3 |
| AUG | UGU | UGC | GCU | GCC | GCA | GCG | GGU | GGC | GGA | GGG | CCU | CCC | CCA | CCG | ACU |
| 3 | 0 | 0 | 6 | 6 | 7 | 0 | 1 | 4 | 4 | 1 | 2 | 4 | 6 | 0 | 4 |
| ACC | ACA | ACG | UCU | UCC | UCA | UCG | AGU | AGC | UAU | UAC | UGG | UUG | AAU | AAC | CAU |
| 6 | 14 | 0 | 2 | 1 | 6 | 0 | 3 | 2 | 1 | 1 | 0 | 1 | 4 | 7 | 2 |
| CAC | GAA | GAG | GAU | GAC | AAA | AAG | CGU | CGC | CGA | CGG | AGA | AGG | UAA | UAG | UGA |
| 4 | 2 | 1 | 2 | 0 | 3 | 1 | 0 | 3 | 1 | 0 | 0 | 0 | 1 | 0 | 3 |
| Codons with 1st base G | Codons with 1st base C | Codons with 1st base A | Codons with 1st base U | ||||||||||||
| 43 | 66 | 81 | 37 | ||||||||||||
| Codons with 2nd base G | Codons with 2nd base C | Codons with 2nd base A | Codons with 2nd base U | ||||||||||||
| 22 | 64 | 38 | 103 | ||||||||||||
| Codons with 3rd base G | Codons with 3rd base C | Codons with 3rd base A | Codons with 3rd base U | ||||||||||||
| 10 | 58 | 98 | 61 | ||||||||||||
| ATP8 (size: 201 bases) | |||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Amino acid sequence: MPQLDTSTWLTMILSMFLVLFIIFQLKISKHNFYHNPEPTWMKMPKQDNPWETKWTKIYLPLSLPL* | |||||||||||||||
| Amino acid frequencies: |
|||||||||||||||
| Codon statistics: | |||||||||||||||
| AUU | AUC | AUA | CUU | CUC | CUA | CUG | UUA | CAA | CAG | GUU | GUC | GUA | GUG | UUU | UUC |
| 1 | 4 | 3 | 3 | 0 | 3 | 1 | 2 | 3 | 0 | 0 | 1 | 0 | 0 | 0 | 4 |
| AUG | UGU | UGC | GCU | GCC | GCA | GCG | GGU | GGC | GGA | GGG | CCU | CCC | CCA | CCG | ACU |
| 2 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 2 | 4 | 0 | 0 |
| ACC | ACA | ACG | UCU | UCC | UCA | UCG | AGU | AGC | UAU | UAC | UGG | UUG | AAU | AAC | CAU |
| 0 | 5 | 1 | 1 | 0 | 3 | 0 | 0 | 0 | 1 | 1 | 0 | 1 | 0 | 3 | 1 |
| CAC | GAA | GAG | GAU | GAC | AAA | AAG | CGU | CGC | CGA | CGG | AGA | AGG | UAA | UAG | UGA |
| 1 | 2 | 0 | 1 | 1 | 5 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 4 |
| Codons with 1st base G | Codons with 1st base C | Codons with 1st base A | Codons with 1st base U | ||||||||||||
| 5 | 19 | 25 | 18 | ||||||||||||
| Codons with 2nd base G | Codons with 2nd base C | Codons with 2nd base A | Codons with 2nd base U | ||||||||||||
| 4 | 17 | 21 | 25 | ||||||||||||
| Codons with 3rd base G | Codons with 3rd base C | Codons with 3rd base A | Codons with 3rd base U | ||||||||||||
| 6 | 17 | 35 | 9 | ||||||||||||
| COX1 (size: 1545 bases) | |||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Amino acid sequence: | |||||||||||||||
| Amino acid frequencies: |
|||||||||||||||
| Codon statistics: | |||||||||||||||
| AUU | AUC | AUA | CUU | CUC | CUA | CUG | UUA | CAA | CAG | GUU | GUC | GUA | GUG | UUU | UUC |
| 23 | 14 | 27 | 5 | 7 | 33 | 2 | 13 | 4 | 2 | 6 | 8 | 20 | 4 | 15 | 27 |
| AUG | UGU | UGC | GCU | GCC | GCA | GCG | GGU | GGC | GGA | GGG | CCU | CCC | CCA | CCG | ACU |
| 7 | 1 | 0 | 8 | 13 | 18 | 1 | 5 | 14 | 17 | 11 | 9 | 11 | 8 | 0 | 8 |
| ACC | ACA | ACG | UCU | UCC | UCA | UCG | AGU | AGC | UAU | UAC | UGG | UUG | AAU | AAC | CAU |
| 11 | 19 | 1 | 8 | 6 | 12 | 0 | 0 | 3 | 10 | 9 | 1 | 0 | 5 | 14 | 8 |
| CAC | GAA | GAG | GAU | GAC | AAA | AAG | CGU | CGC | CGA | CGG | AGA | AGG | UAA | UAG | UGA |
| 9 | 6 | 3 | 8 | 7 | 9 | 0 | 0 | 2 | 5 | 1 | 0 | 0 | 1 | 0 | 16 |
| Codons with 1st base G | Codons with 1st base C | Codons with 1st base A | Codons with 1st base U | ||||||||||||
| 149 | 106 | 141 | 119 | ||||||||||||
| Codons with 2nd base G | Codons with 2nd base C | Codons with 2nd base A | Codons with 2nd base U | ||||||||||||
| 76 | 133 | 95 | 211 | ||||||||||||
| Codons with 3rd base G | Codons with 3rd base C | Codons with 3rd base A | Codons with 3rd base U | ||||||||||||
| 33 | 155 | 208 | 119 | ||||||||||||
| COX2 (size: 684 bases) | |||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Amino acid sequence: | |||||||||||||||
| Amino acid frequencies: |
|||||||||||||||
| Codon statistics: | |||||||||||||||
| AUU | AUC | AUA | CUU | CUC | CUA | CUG | UUA | CAA | CAG | GUU | GUC | GUA | GUG | UUU | UUC |
| 9 | 10 | 13 | 3 | 2 | 14 | 4 | 7 | 5 | 1 | 0 | 4 | 5 | 2 | 4 | 2 |
| AUG | UGU | UGC | GCU | GCC | GCA | GCG | GGU | GGC | GGA | GGG | CCU | CCC | CCA | CCG | ACU |
| 4 | 1 | 1 | 1 | 1 | 6 | 0 | 1 | 1 | 4 | 2 | 1 | 3 | 8 | 1 | 4 |
| ACC | ACA | ACG | UCU | UCC | UCA | UCG | AGU | AGC | UAU | UAC | UGG | UUG | AAU | AAC | CAU |
| 3 | 9 | 2 | 5 | 2 | 8 | 1 | 1 | 4 | 4 | 7 | 0 | 3 | 2 | 3 | 4 |
| CAC | GAA | GAG | GAU | GAC | AAA | AAG | CGU | CGC | CGA | CGG | AGA | AGG | UAA | UAG | UGA |
| 3 | 15 | 1 | 3 | 7 | 5 | 0 | 0 | 1 | 5 | 0 | 0 | 0 | 1 | 0 | 5 |
| Codons with 1st base G | Codons with 1st base C | Codons with 1st base A | Codons with 1st base U | ||||||||||||
| 53 | 55 | 69 | 51 | ||||||||||||
| Codons with 2nd base G | Codons with 2nd base C | Codons with 2nd base A | Codons with 2nd base U | ||||||||||||
| 26 | 55 | 61 | 86 | ||||||||||||
| Codons with 3rd base G | Codons with 3rd base C | Codons with 3rd base A | Codons with 3rd base U | ||||||||||||
| 21 | 54 | 110 | 43 | ||||||||||||
| COX3 (size: 784 bases) | |||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Amino acid sequence: | |||||||||||||||
| Amino acid frequencies: |
|||||||||||||||
| Codon statistics: | |||||||||||||||
| AUU | AUC | AUA | CUU | CUC | CUA | CUG | UUA | CAA | CAG | GUU | GUC | GUA | GUG | UUU | UUC |
| 6 | 9 | 7 | 4 | 8 | 11 | 2 | 7 | 7 | 0 | 2 | 7 | 6 | 0 | 9 | 15 |
| AUG | UGU | UGC | GCU | GCC | GCA | GCG | GGU | GGC | GGA | GGG | CCU | CCC | CCA | CCG | ACU |
| 2 | 1 | 1 | 5 | 9 | 2 | 0 | 1 | 10 | 9 | 0 | 2 | 6 | 3 | 1 | 4 |
| ACC | ACA | ACG | UCU | UCC | UCA | UCG | AGU | AGC | UAU | UAC | UGG | UUG | AAU | AAC | CAU |
| 6 | 12 | 2 | 5 | 1 | 9 | 0 | 2 | 3 | 8 | 3 | 1 | 0 | 3 | 5 | 5 |
| CAC | GAA | GAG | GAU | GAC | AAA | AAG | CGU | CGC | CGA | CGG | AGA | AGG | UAA | UAG | UGA |
| 11 | 7 | 1 | 2 | 1 | 2 | 0 | 0 | 3 | 2 | 0 | 0 | 0 | 0 | 0 | 11 |
| Codons with 1st base G | Codons with 1st base C | Codons with 1st base A | Codons with 1st base U | ||||||||||||
| 62 | 65 | 63 | 71 | ||||||||||||
| Codons with 2nd base G | Codons with 2nd base C | Codons with 2nd base A | Codons with 2nd base U | ||||||||||||
| 44 | 67 | 55 | 95 | ||||||||||||
| Codons with 3rd base G | Codons with 3rd base C | Codons with 3rd base A | Codons with 3rd base U | ||||||||||||
| 9 | 98 | 95 | 59 | ||||||||||||
| CYTB (size: 1140 bases) | |||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Amino acid sequence: | |||||||||||||||
| Amino acid frequencies: |
|||||||||||||||
| Codon statistics: | |||||||||||||||
| AUU | AUC | AUA | CUU | CUC | CUA | CUG | UUA | CAA | CAG | GUU | GUC | GUA | GUG | UUU | UUC |
| 16 | 26 | 14 | 3 | 17 | 24 | 4 | 8 | 6 | 0 | 2 | 5 | 7 | 2 | 5 | 21 |
| AUG | UGU | UGC | GCU | GCC | GCA | GCG | GGU | GGC | GGA | GGG | CCU | CCC | CCA | CCG | ACU |
| 4 | 1 | 3 | 2 | 6 | 16 | 0 | 3 | 7 | 13 | 2 | 4 | 5 | 13 | 1 | 5 |
| ACC | ACA | ACG | UCU | UCC | UCA | UCG | AGU | AGC | UAU | UAC | UGG | UUG | AAU | AAC | CAU |
| 5 | 14 | 2 | 3 | 6 | 9 | 1 | 0 | 2 | 6 | 9 | 0 | 0 | 5 | 12 | 4 |
| CAC | GAA | GAG | GAU | GAC | AAA | AAG | CGU | CGC | CGA | CGG | AGA | AGG | UAA | UAG | UGA |
| 8 | 5 | 0 | 2 | 9 | 10 | 1 | 0 | 0 | 7 | 1 | 1 | 0 | 0 | 0 | 12 |
| Codons with 1st base G | Codons with 1st base C | Codons with 1st base A | Codons with 1st base U | ||||||||||||
| 81 | 97 | 117 | 84 | ||||||||||||
| Codons with 2nd base G | Codons with 2nd base C | Codons with 2nd base A | Codons with 2nd base U | ||||||||||||
| 52 | 92 | 77 | 158 | ||||||||||||
| Codons with 3rd base G | Codons with 3rd base C | Codons with 3rd base A | Codons with 3rd base U | ||||||||||||
| 18 | 141 | 159 | 61 | ||||||||||||
| ND1 (size: 956 bases) | |||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Amino acid sequence: | |||||||||||||||
| Amino acid frequencies: |
|||||||||||||||
| Codon statistics: | |||||||||||||||
| AUU | AUC | AUA | CUU | CUC | CUA | CUG | UUA | CAA | CAG | GUU | GUC | GUA | GUG | UUU | UUC |
| 13 | 16 | 17 | 7 | 7 | 25 | 4 | 11 | 7 | 0 | 0 | 6 | 6 | 1 | 10 | 11 |
| AUG | UGU | UGC | GCU | GCC | GCA | GCG | GGU | GGC | GGA | GGG | CCU | CCC | CCA | CCG | ACU |
| 4 | 0 | 1 | 2 | 12 | 14 | 0 | 0 | 7 | 5 | 1 | 0 | 13 | 5 | 4 | 3 |
| ACC | ACA | ACG | UCU | UCC | UCA | UCG | AGU | AGC | UAU | UAC | UGG | UUG | AAU | AAC | CAU |
| 6 | 13 | 0 | 2 | 6 | 11 | 0 | 0 | 3 | 3 | 9 | 1 | 0 | 3 | 9 | 0 |
| CAC | GAA | GAG | GAU | GAC | AAA | AAG | CGU | CGC | CGA | CGG | AGA | AGG | UAA | UAG | UGA |
| 3 | 11 | 0 | 1 | 2 | 7 | 0 | 0 | 1 | 7 | 0 | 0 | 0 | 0 | 0 | 8 |
| Codons with 1st base G | Codons with 1st base C | Codons with 1st base A | Codons with 1st base U | ||||||||||||
| 68 | 83 | 94 | 73 | ||||||||||||
| Codons with 2nd base G | Codons with 2nd base C | Codons with 2nd base A | Codons with 2nd base U | ||||||||||||
| 34 | 91 | 55 | 138 | ||||||||||||
| Codons with 3rd base G | Codons with 3rd base C | Codons with 3rd base A | Codons with 3rd base U | ||||||||||||
| 15 | 112 | 147 | 44 | ||||||||||||
| ND2 (size: 1042 bases) | |||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Amino acid sequence: | |||||||||||||||
| Amino acid frequencies: |
|||||||||||||||
| Codon statistics: | |||||||||||||||
| AUU | AUC | AUA | CUU | CUC | CUA | CUG | UUA | CAA | CAG | GUU | GUC | GUA | GUG | UUU | UUC |
| 12 | 26 | 35 | 7 | 9 | 25 | 2 | 9 | 9 | 1 | 2 | 2 | 7 | 0 | 6 | 6 |
| AUG | UGU | UGC | GCU | GCC | GCA | GCG | GGU | GGC | GGA | GGG | CCU | CCC | CCA | CCG | ACU |
| 4 | 0 | 0 | 4 | 9 | 7 | 0 | 0 | 5 | 8 | 1 | 2 | 6 | 11 | 0 | 7 |
| ACC | ACA | ACG | UCU | UCC | UCA | UCG | AGU | AGC | UAU | UAC | UGG | UUG | AAU | AAC | CAU |
| 14 | 20 | 0 | 3 | 10 | 14 | 0 | 0 | 1 | 3 | 6 | 1 | 0 | 5 | 12 | 1 |
| CAC | GAA | GAG | GAU | GAC | AAA | AAG | CGU | CGC | CGA | CGG | AGA | AGG | UAA | UAG | UGA |
| 4 | 3 | 2 | 1 | 0 | 13 | 0 | 0 | 0 | 3 | 0 | 0 | 0 | 0 | 0 | 9 |
| Codons with 1st base G | Codons with 1st base C | Codons with 1st base A | Codons with 1st base U | ||||||||||||
| 51 | 80 | 149 | 67 | ||||||||||||
| Codons with 2nd base G | Codons with 2nd base C | Codons with 2nd base A | Codons with 2nd base U | ||||||||||||
| 28 | 107 | 60 | 152 | ||||||||||||
| Codons with 3rd base G | Codons with 3rd base C | Codons with 3rd base A | Codons with 3rd base U | ||||||||||||
| 11 | 110 | 173 | 53 | ||||||||||||
| ND3 (size: 1042 bases) | |||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Amino acid sequence: | |||||||||||||||
| Amino acid frequencies: |
|||||||||||||||
| Codon statistics: | |||||||||||||||
| AUU | AUC | AUA | CUU | CUC | CUA | CUG | UUA | CAA | CAG | GUU | GUC | GUA | GUG | UUU | UUC |
| 12 | 26 | 35 | 7 | 9 | 25 | 2 | 9 | 9 | 1 | 2 | 2 | 7 | 0 | 6 | 6 |
| AUG | UGU | UGC | GCU | GCC | GCA | GCG | GGU | GGC | GGA | GGG | CCU | CCC | CCA | CCG | ACU |
| 4 | 0 | 0 | 4 | 9 | 7 | 0 | 0 | 5 | 8 | 1 | 2 | 6 | 11 | 0 | 7 |
| ACC | ACA | ACG | UCU | UCC | UCA | UCG | AGU | AGC | UAU | UAC | UGG | UUG | AAU | AAC | CAU |
| 14 | 20 | 0 | 3 | 10 | 14 | 0 | 0 | 1 | 3 | 6 | 1 | 0 | 5 | 12 | 1 |
| CAC | GAA | GAG | GAU | GAC | AAA | AAG | CGU | CGC | CGA | CGG | AGA | AGG | UAA | UAG | UGA |
| 4 | 3 | 2 | 1 | 0 | 13 | 0 | 0 | 0 | 3 | 0 | 0 | 0 | 0 | 0 | 9 |
| Codons with 1st base G | Codons with 1st base C | Codons with 1st base A | Codons with 1st base U | ||||||||||||
| 51 | 80 | 149 | 67 | ||||||||||||
| Codons with 2nd base G | Codons with 2nd base C | Codons with 2nd base A | Codons with 2nd base U | ||||||||||||
| 28 | 107 | 60 | 152 | ||||||||||||
| Codons with 3rd base G | Codons with 3rd base C | Codons with 3rd base A | Codons with 3rd base U | ||||||||||||
| 11 | 110 | 173 | 53 | ||||||||||||
| ND4 (size: 1378 bases) | |||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Amino acid sequence: | |||||||||||||||
| Amino acid frequencies: |
|||||||||||||||
| Codon statistics: | |||||||||||||||
| AUU | AUC | AUA | CUU | CUC | CUA | CUG | UUA | CAA | CAG | GUU | GUC | GUA | GUG | UUU | UUC |
| 24 | 19 | 29 | 10 | 17 | 46 | 9 | 13 | 11 | 0 | 3 | 3 | 6 | 1 | 6 | 15 |
| AUG | UGU | UGC | GCU | GCC | GCA | GCG | GGU | GGC | GGA | GGG | CCU | CCC | CCA | CCG | ACU |
| 6 | 1 | 2 | 6 | 9 | 11 | 2 | 2 | 7 | 7 | 1 | 7 | 6 | 9 | 0 | 5 |
| ACC | ACA | ACG | UCU | UCC | UCA | UCG | AGU | AGC | UAU | UAC | UGG | UUG | AAU | AAC | CAU |
| 7 | 21 | 2 | 6 | 12 | 8 | 1 | 3 | 8 | 8 | 9 | 1 | 1 | 5 | 20 | 3 |
| CAC | GAA | GAG | GAU | GAC | AAA | AAG | CGU | CGC | CGA | CGG | AGA | AGG | UAA | UAG | UGA |
| 8 | 6 | 2 | 2 | 1 | 10 | 1 | 1 | 3 | 6 | 0 | 0 | 0 | 0 | 0 | 11 |
| Codons with 1st base G | Codons with 1st base C | Codons with 1st base A | Codons with 1st base U | ||||||||||||
| 69 | 136 | 160 | 94 | ||||||||||||
| Codons with 2nd base G | Codons with 2nd base C | Codons with 2nd base A | Codons with 2nd base U | ||||||||||||
| 53 | 112 | 86 | 208 | ||||||||||||
| Codons with 3rd base G | Codons with 3rd base C | Codons with 3rd base A | Codons with 3rd base U | ||||||||||||
| 27 | 146 | 194 | 92 | ||||||||||||
| ND4L (size: 297 bases) | |||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Amino acid sequence: | |||||||||||||||
| Amino acid frequencies: |
|||||||||||||||
| Codon statistics: | |||||||||||||||
| AUU | AUC | AUA | CUU | CUC | CUA | CUG | UUA | CAA | CAG | GUU | GUC | GUA | GUG | UUU | UUC |
| 2 | 3 | 7 | 2 | 2 | 11 | 3 | 4 | 2 | 0 | 0 | 0 | 6 | 0 | 1 | 3 |
| AUG | UGU | UGC | GCU | GCC | GCA | GCG | GGU | GGC | GGA | GGG | CCU | CCC | CCA | CCG | ACU |
| 5 | 1 | 2 | 1 | 2 | 5 | 0 | 2 | 0 | 2 | 0 | 0 | 1 | 0 | 0 | 1 |
| ACC | ACA | ACG | UCU | UCC | UCA | UCG | AGU | AGC | UAU | UAC | UGG | UUG | AAU | AAC | CAU |
| 2 | 3 | 0 | 1 | 6 | 2 | 0 | 0 | 1 | 2 | 1 | 0 | 0 | 0 | 5 | 1 |
| CAC | GAA | GAG | GAU | GAC | AAA | AAG | CGU | CGC | CGA | CGG | AGA | AGG | UAA | UAG | UGA |
| 2 | 2 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 1 | 0 | 0 |
| Codons with 1st base G | Codons with 1st base C | Codons with 1st base A | Codons with 1st base U | ||||||||||||
| 21 | 25 | 29 | 24 | ||||||||||||
| Codons with 2nd base G | Codons with 2nd base C | Codons with 2nd base A | Codons with 2nd base U | ||||||||||||
| 9 | 24 | 17 | 49 | ||||||||||||
| Codons with 3rd base G | Codons with 3rd base C | Codons with 3rd base A | Codons with 3rd base U | ||||||||||||
| 8 | 30 | 46 | 15 | ||||||||||||
| ND5 (size: 1821 bases) | |||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Amino acid sequence: | |||||||||||||||
| Amino acid frequencies: |
|||||||||||||||
| Codon statistics: | |||||||||||||||
| AUU | AUC | AUA | CUU | CUC | CUA | CUG | UUA | CAA | CAG | GUU | GUC | GUA | GUG | UUU | UUC |
| 24 | 39 | 38 | 12 | 14 | 45 | 6 | 9 | 17 | 1 | 2 | 5 | 6 | 0 | 15 | 33 |
| AUG | UGU | UGC | GCU | GCC | GCA | GCG | GGU | GGC | GGA | GGG | CCU | CCC | CCA | CCG | ACU |
| 4 | 3 | 1 | 4 | 15 | 23 | 1 | 3 | 10 | 14 | 0 | 4 | 12 | 10 | 0 | 6 |
| ACC | ACA | ACG | UCU | UCC | UCA | UCG | AGU | AGC | UAU | UAC | UGG | UUG | AAU | AAC | CAU |
| 19 | 27 | 1 | 8 | 15 | 15 | 0 | 1 | 11 | 7 | 12 | 0 | 0 | 9 | 27 | 2 |
| CAC | GAA | GAG | GAU | GAC | AAA | AAG | CGU | CGC | CGA | CGG | AGA | AGG | UAA | UAG | UGA |
| 11 | 9 | 2 | 4 | 7 | 22 | 1 | 1 | 4 | 3 | 0 | 0 | 0 | 1 | 0 | 12 |
| Codons with 1st base G | Codons with 1st base C | Codons with 1st base A | Codons with 1st base U | ||||||||||||
| 105 | 142 | 229 | 131 | ||||||||||||
| Codons with 2nd base G | Codons with 2nd base C | Codons with 2nd base A | Codons with 2nd base U | ||||||||||||
| 63 | 160 | 132 | 252 | ||||||||||||
| Codons with 3rd base G | Codons with 3rd base C | Codons with 3rd base A | Codons with 3rd base U | ||||||||||||
| 16 | 235 | 251 | 105 | ||||||||||||
| ND6 (size: 528 bases) | |||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Amino acid sequence: | |||||||||||||||
| Amino acid frequencies: |
|||||||||||||||
| Codon statistics: | |||||||||||||||
| AUU | AUC | AUA | CUU | CUC | CUA | CUG | UUA | CAA | CAG | GUU | GUC | GUA | GUG | UUU | UUC |
| 16 | 1 | 6 | 0 | 0 | 2 | 0 | 6 | 0 | 1 | 11 | 2 | 2 | 8 | 13 | 0 |
| AUG | UGU | UGC | GCU | GCC | GCA | GCG | GGU | GGC | GGA | GGG | CCU | CCC | CCA | CCG | ACU |
| 5 | 1 | 0 | 4 | 0 | 0 | 2 | 7 | 1 | 5 | 13 | 3 | 0 | 0 | 0 | 6 |
| ACC | ACA | ACG | UCU | UCC | UCA | UCG | AGU | AGC | UAU | UAC | UGG | UUG | AAU | AAC | CAU |
| 0 | 1 | 1 | 4 | 1 | 1 | 1 | 5 | 0 | 9 | 1 | 1 | 11 | 3 | 0 | 0 |
| CAC | GAA | GAG | GAU | GAC | AAA | AAG | CGU | CGC | CGA | CGG | AGA | AGG | UAA | UAG | UGA |
| 0 | 4 | 5 | 4 | 0 | 2 | 2 | 1 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 3 |
| Codons with 1st base G | Codons with 1st base C | Codons with 1st base A | Codons with 1st base U | ||||||||||||
| 68 | 7 | 48 | 53 | ||||||||||||
| Codons with 2nd base G | Codons with 2nd base C | Codons with 2nd base A | Codons with 2nd base U | ||||||||||||
| 37 | 24 | 32 | 83 | ||||||||||||
| Codons with 3rd base G | Codons with 3rd base C | Codons with 3rd base A | Codons with 3rd base U | ||||||||||||
| 50 | 6 | 33 | 87 | ||||||||||||
| Total protein-coding genes (size: 11403 bases) | |||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Amino acid sequence: | |||||||||||||||
| Amino acid frequencies: |
|||||||||||||||
| Codon statistics: | |||||||||||||||
| AUU | AUC | AUA | CUU | CUC | CUA | CUG | UUA | CAA | CAG | GUU | GUC | GUA | GUG | UUU | UUC |
| 168 | 176 | 208 | 65 | 99 | 268 | 41 | 102 | 82 | 7 | 29 | 46 | 80 | 19 | 95 | 146 |
| AUG | UGU | UGC | GCU | GCC | GCA | GCG | GGU | GGC | GGA | GGG | CCU | CCC | CCA | CCG | ACU |
| 51 | 10 | 12 | 44 | 89 | 111 | 6 | 25 | 66 | 91 | 32 | 36 | 71 | 80 | 7 | 56 |
| ACC | ACA | ACG | UCU | UCC | UCA | UCG | AGU | AGC | UAU | UAC | UGG | UUG | AAU | AAC | CAU |
| 82 | 164 | 12 | 49 | 67 | 100 | 4 | 15 | 40 | 63 | 70 | 6 | 17 | 45 | 121 | 31 |
| CAC | GAA | GAG | GAU | GAC | AAA | AAG | CGU | CGC | CGA | CGG | AGA | AGG | UAA | UAG | UGA |
| 64 | 76 | 19 | 32 | 36 | 91 | 7 | 3 | 18 | 40 | 2 | 1 | 0 | 7 | 0 | 98 |
| Codons with 1st base G | Codons with 1st base C | Codons with 1st base A | Codons with 1st base U | ||||||||||||
| 801 | 914 | 1237 | 846 | ||||||||||||
| Codons with 2nd base G | Codons with 2nd base C | Codons with 2nd base A | Codons with 2nd base U | ||||||||||||
| 459 | 978 | 751 | 1610 | ||||||||||||
| Codons with 3rd base G | Codons with 3rd base C | Codons with 3rd base A | Codons with 3rd base U | ||||||||||||
| 230 | 1203 | 1599 | 766 | ||||||||||||
Error: F​a​i​l​e​d​ t​o​ u​n​d​e​r​s​t​a​n​d​ i​d​:​ ?​t​e​r​m​=​(​"​H​i​p​p​o​t​r​a​g​u​s​ F​a​i​l​e​d​ t​o​ u​n​d​e​r​s​t​a​n​d​ i​d​:​ n​i​g​e​r​"​[​O​r​g​a​n​i​s​m​]​)​ F​a​i​l​e​d​ t​o​ u​n​d​e​r​s​t​a​n​d​ i​d​:​ A​N​D​ F​a​i​l​e​d​ t​o​ u​n​d​e​r​s​t​a​n​d​ i​d​:​ (​r​e​f​s​e​q​[​f​i​l​t​e​r​]​ F​a​i​l​e​d​ t​o​ u​n​d​e​r​s​t​a​n​d​ i​d​:​ A​N​D​ F​a​i​l​e​d​ t​o​ u​n​d​e​r​s​t​a​n​d​ i​d​:​ m​i​t​o​c​h​o​n​d​r​i​o​n​[​f​i​l​t​e​r​]​)​