Viewing data for Hippotragus niger


Scientific name Hippotragus niger
Common name Sable antelope
Maximum lifespan 22.20 years (Hippotragus niger@AnAge)

Total mtDNA (size: 16507 bases) GC AT G C A T
Base content (bases) 6614 9892 4377 2237 4392 5500
Base content per 1 kb (bases) 401 599 265 136 266 333
Base content (%) 40.1% 59.9%
Total protein-coding genes (size: 11338 bases) GC AT G C A T
Base content (bases) 4567 6770 3200 1367 3095 3675
Base content per 1 kb (bases) 403 597 282 121 273 324
Base content (%) 40.3% 59.7%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1506 bases) GC AT G C A T
Base content (bases) 553 953 321 232 417 536
Base content per 1 kb (bases) 367 633 213 154 277 356
Base content (%) 36.7% 63.3%
Total rRNA-coding genes (size: 2524 bases) GC AT G C A T
Base content (bases) 1024 1500 567 457 577 923
Base content per 1 kb (bases) 406 594 225 181 229 366
Base content (%) 40.6% 59.4%
12S rRNA gene (size: 954 bases) GC AT G C A T
Base content (bases) 398 556 224 174 209 347
Base content per 1 kb (bases) 417 583 235 182 219 364
Base content (%) 41.7% 58.3%
16S rRNA gene (size: 1570 bases) GC AT G C A T
Base content (bases) 626 944 343 283 368 576
Base content per 1 kb (bases) 399 601 218 180 234 367
Base content (%) 39.9% 60.1%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 263 418 188 75 201 217
Base content per 1 kb (bases) 386 614 276 110 295 319
Base content (%) 38.6% 61.4%
ATP8 (size: 201 bases) GC AT G C A T
Base content (bases) 68 133 53 15 52 81
Base content per 1 kb (bases) 338 662 264 75 259 403
Base content (%) 33.8% 66.2%
COX1 (size: 1545 bases) GC AT G C A T
Base content (bases) 652 893 394 258 449 444
Base content per 1 kb (bases) 422 578 255 167 291 287
Base content (%) 42.2% 57.8%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 264 420 164 100 180 240
Base content per 1 kb (bases) 386 614 240 146 263 351
Base content (%) 38.6% 61.4%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 345 439 230 115 226 213
Base content per 1 kb (bases) 440 560 293 147 288 272
Base content (%) 44.0% 56.0%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 483 656 331 152 303 353
Base content per 1 kb (bases) 424 575 290 133 266 310
Base content (%) 42.4% 57.5%
ND1 (size: 956 bases) GC AT G C A T
Base content (bases) 403 553 286 117 256 297
Base content per 1 kb (bases) 422 578 299 122 268 311
Base content (%) 42.2% 57.8%
ND2 (size: 1042 bases) GC AT G C A T
Base content (bases) 387 655 297 90 273 382
Base content per 1 kb (bases) 371 629 285 86 262 367
Base content (%) 37.1% 62.9%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 149 197 106 43 93 104
Base content per 1 kb (bases) 431 569 306 124 269 301
Base content (%) 43.1% 56.9%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 543 835 394 149 395 440
Base content per 1 kb (bases) 394 606 286 108 287 319
Base content (%) 39.4% 60.6%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 117 180 79 38 88 92
Base content per 1 kb (bases) 394 606 266 128 296 310
Base content (%) 39.4% 60.6%
ND5 (size: 1821 bases) GC AT G C A T
Base content (bases) 721 1100 537 184 488 612
Base content per 1 kb (bases) 396 604 295 101 268 336
Base content (%) 39.6% 60.4%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 192 336 155 37 113 223
Base content per 1 kb (bases) 364 636 294 70 214 422
Base content (%) 36.4% 63.6%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 10 (4.42%)
Alanine (Ala, A)
n = 19 (8.41%)
Serine (Ser, S)
n = 14 (6.19%)
Threonine (Thr, T)
n = 24 (10.62%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (3.98%)
Leucine (Leu, L)
n = 45 (19.91%)
Isoleucine (Ile, I)
n = 26 (11.5%)
Methionine (Met, M)
n = 11 (4.87%)
Proline (Pro, P)
n = 12 (5.31%)
Phenylalanine (Phe, F)
n = 12 (5.31%)
Tyrosine (Tyr, Y)
n = 2 (0.88%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 2 (0.88%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 11 (4.87%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 6 (2.65%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 4 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 7 8 5 8 19 3 9 9 0 1 2 6 0 9 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 6 6 7 0 1 4 4 1 2 4 6 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 14 0 2 1 6 0 3 2 1 1 0 1 4 7 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 2 1 2 0 3 1 0 3 1 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
43 66 81 37
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
22 64 38 103
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 58 98 61
ATP8 (size: 201 bases)
Amino acid sequence: MPQLDTSTWLTMILSMFLVLFIIFQLKISKHNFYHNPEPTWMKMPKQDNPWETKWTKIYLPLSLPL*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 4 (6.06%)
Threonine (Thr, T)
n = 6 (9.09%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.52%)
Leucine (Leu, L)
n = 10 (15.15%)
Isoleucine (Ile, I)
n = 5 (7.58%)
Methionine (Met, M)
n = 5 (7.58%)
Proline (Pro, P)
n = 7 (10.61%)
Phenylalanine (Phe, F)
n = 4 (6.06%)
Tyrosine (Tyr, Y)
n = 2 (3.03%)
Tryptophan (Trp, W)
n = 4 (6.06%)
Aspartic acid (Asp, D)
n = 2 (3.03%)
Glutamic acid (Glu, E)
n = 2 (3.03%)
Asparagine (Asn, N)
n = 3 (4.55%)
Glutamine (Gln, Q)
n = 3 (4.55%)
Histidine (His, H)
n = 2 (3.03%)
Lysine (Lys, K)
n = 6 (9.09%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 4 3 3 0 3 1 2 3 0 0 1 0 0 0 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 0 0 0 0 0 0 0 0 1 2 4 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 5 1 1 0 3 0 0 0 1 1 0 1 0 3 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 1 1 5 1 0 0 0 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
5 19 25 18
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
4 17 21 25
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 17 35 9
COX1 (size: 1545 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.14%)
Alanine (Ala, A)
n = 40 (7.78%)
Serine (Ser, S)
n = 29 (5.64%)
Threonine (Thr, T)
n = 39 (7.59%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 38 (7.39%)
Leucine (Leu, L)
n = 60 (11.67%)
Isoleucine (Ile, I)
n = 37 (7.2%)
Methionine (Met, M)
n = 34 (6.61%)
Proline (Pro, P)
n = 28 (5.45%)
Phenylalanine (Phe, F)
n = 42 (8.17%)
Tyrosine (Tyr, Y)
n = 19 (3.7%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 15 (2.92%)
Glutamic acid (Glu, E)
n = 9 (1.75%)
Asparagine (Asn, N)
n = 19 (3.7%)
Glutamine (Gln, Q)
n = 6 (1.17%)
Histidine (His, H)
n = 17 (3.31%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 14 27 5 7 33 2 13 4 2 6 8 20 4 15 27
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 1 0 8 13 18 1 5 14 17 11 9 11 8 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 19 1 8 6 12 0 0 3 10 9 1 0 5 14 8
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 6 3 8 7 9 0 0 2 5 1 0 0 1 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
149 106 141 119
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 133 95 211
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
33 155 208 119
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 8 (3.52%)
Serine (Ser, S)
n = 21 (9.25%)
Threonine (Thr, T)
n = 18 (7.93%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 11 (4.85%)
Leucine (Leu, L)
n = 33 (14.54%)
Isoleucine (Ile, I)
n = 19 (8.37%)
Methionine (Met, M)
n = 17 (7.49%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 6 (2.64%)
Tyrosine (Tyr, Y)
n = 11 (4.85%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 10 (4.41%)
Glutamic acid (Glu, E)
n = 16 (7.05%)
Asparagine (Asn, N)
n = 5 (2.2%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 7 (3.08%)
Lysine (Lys, K)
n = 5 (2.2%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 10 13 3 2 14 4 7 5 1 0 4 5 2 4 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 1 1 1 6 0 1 1 4 2 1 3 8 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 9 2 5 2 8 1 1 4 4 7 0 3 2 3 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 15 1 3 7 5 0 0 1 5 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
53 55 69 51
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 55 61 86
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 54 110 43
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 16 (6.15%)
Serine (Ser, S)
n = 20 (7.69%)
Threonine (Thr, T)
n = 24 (9.23%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 15 (5.77%)
Leucine (Leu, L)
n = 32 (12.31%)
Isoleucine (Ile, I)
n = 15 (5.77%)
Methionine (Met, M)
n = 9 (3.46%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 8 (3.08%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 9 7 4 8 11 2 7 7 0 2 7 6 0 9 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 1 5 9 2 0 1 10 9 0 2 6 3 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 12 2 5 1 9 0 2 3 8 3 1 0 3 5 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 7 1 2 1 2 0 0 3 2 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
62 65 63 71
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 67 55 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 98 95 59
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (6.6%)
Alanine (Ala, A)
n = 25 (6.6%)
Serine (Ser, S)
n = 21 (5.54%)
Threonine (Thr, T)
n = 26 (6.86%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 16 (4.22%)
Leucine (Leu, L)
n = 56 (14.78%)
Isoleucine (Ile, I)
n = 42 (11.08%)
Methionine (Met, M)
n = 18 (4.75%)
Proline (Pro, P)
n = 23 (6.07%)
Phenylalanine (Phe, F)
n = 26 (6.86%)
Tyrosine (Tyr, Y)
n = 15 (3.96%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 5 (1.32%)
Asparagine (Asn, N)
n = 17 (4.49%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 11 (2.9%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 26 14 3 17 24 4 8 6 0 2 5 7 2 5 21
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 3 2 6 16 0 3 7 13 2 4 5 13 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 14 2 3 6 9 1 0 2 6 9 0 0 5 12 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 5 0 2 9 10 1 0 0 7 1 1 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
81 97 117 84
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 92 77 158
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 141 159 61
ND1 (size: 956 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (4.1%)
Alanine (Ala, A)
n = 28 (8.83%)
Serine (Ser, S)
n = 22 (6.94%)
Threonine (Thr, T)
n = 22 (6.94%)
Cysteine (Cys, C)
n = 1 (0.32%)
Valine (Val, V)
n = 13 (4.1%)
Leucine (Leu, L)
n = 54 (17.03%)
Isoleucine (Ile, I)
n = 29 (9.15%)
Methionine (Met, M)
n = 21 (6.62%)
Proline (Pro, P)
n = 22 (6.94%)
Phenylalanine (Phe, F)
n = 21 (6.62%)
Tyrosine (Tyr, Y)
n = 12 (3.79%)
Tryptophan (Trp, W)
n = 9 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.95%)
Glutamic acid (Glu, E)
n = 11 (3.47%)
Asparagine (Asn, N)
n = 12 (3.79%)
Glutamine (Gln, Q)
n = 7 (2.21%)
Histidine (His, H)
n = 3 (0.95%)
Lysine (Lys, K)
n = 7 (2.21%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 16 17 7 7 25 4 11 7 0 0 6 6 1 10 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 2 12 14 0 0 7 5 1 0 13 5 4 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 13 0 2 6 11 0 0 3 3 9 1 0 3 9 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 11 0 1 2 7 0 0 1 7 0 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 83 94 73
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 91 55 138
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 112 147 44
ND2 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 20 (5.78%)
Serine (Ser, S)
n = 28 (8.09%)
Threonine (Thr, T)
n = 41 (11.85%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 11 (3.18%)
Leucine (Leu, L)
n = 52 (15.03%)
Isoleucine (Ile, I)
n = 38 (10.98%)
Methionine (Met, M)
n = 39 (11.27%)
Proline (Pro, P)
n = 19 (5.49%)
Phenylalanine (Phe, F)
n = 12 (3.47%)
Tyrosine (Tyr, Y)
n = 9 (2.6%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 17 (4.91%)
Glutamine (Gln, Q)
n = 10 (2.89%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 13 (3.76%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 26 35 7 9 25 2 9 9 1 2 2 7 0 6 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 4 9 7 0 0 5 8 1 2 6 11 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 20 0 3 10 14 0 0 1 3 6 1 0 5 12 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 3 2 1 0 13 0 0 0 3 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
51 80 149 67
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
28 107 60 152
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 110 173 53
ND3 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 20 (5.78%)
Serine (Ser, S)
n = 28 (8.09%)
Threonine (Thr, T)
n = 41 (11.85%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 11 (3.18%)
Leucine (Leu, L)
n = 52 (15.03%)
Isoleucine (Ile, I)
n = 38 (10.98%)
Methionine (Met, M)
n = 39 (11.27%)
Proline (Pro, P)
n = 19 (5.49%)
Phenylalanine (Phe, F)
n = 12 (3.47%)
Tyrosine (Tyr, Y)
n = 9 (2.6%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 17 (4.91%)
Glutamine (Gln, Q)
n = 10 (2.89%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 13 (3.76%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 26 35 7 9 25 2 9 9 1 2 2 7 0 6 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 4 9 7 0 0 5 8 1 2 6 11 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 20 0 3 10 14 0 0 1 3 6 1 0 5 12 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 3 2 1 0 13 0 0 0 3 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
51 80 149 67
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
28 107 60 152
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 110 173 53
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (3.71%)
Alanine (Ala, A)
n = 28 (6.11%)
Serine (Ser, S)
n = 38 (8.3%)
Threonine (Thr, T)
n = 35 (7.64%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 13 (2.84%)
Leucine (Leu, L)
n = 96 (20.96%)
Isoleucine (Ile, I)
n = 43 (9.39%)
Methionine (Met, M)
n = 35 (7.64%)
Proline (Pro, P)
n = 22 (4.8%)
Phenylalanine (Phe, F)
n = 21 (4.59%)
Tyrosine (Tyr, Y)
n = 17 (3.71%)
Tryptophan (Trp, W)
n = 12 (2.62%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 8 (1.75%)
Asparagine (Asn, N)
n = 25 (5.46%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 11 (2.4%)
Lysine (Lys, K)
n = 11 (2.4%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
24 19 29 10 17 46 9 13 11 0 3 3 6 1 6 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 2 6 9 11 2 2 7 7 1 7 6 9 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 21 2 6 12 8 1 3 8 8 9 1 1 5 20 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 6 2 2 1 10 1 1 3 6 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 136 160 94
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 112 86 208
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
27 146 194 92
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 8 (8.16%)
Serine (Ser, S)
n = 10 (10.2%)
Threonine (Thr, T)
n = 6 (6.12%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 6 (6.12%)
Leucine (Leu, L)
n = 22 (22.45%)
Isoleucine (Ile, I)
n = 5 (5.1%)
Methionine (Met, M)
n = 12 (12.24%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 3 (3.06%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 5 (5.1%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 3 (3.06%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 3 7 2 2 11 3 4 2 0 0 0 6 0 1 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 2 1 2 5 0 2 0 2 0 0 1 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 3 0 1 6 2 0 0 1 2 1 0 0 0 5 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 0 1 0 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
21 25 29 24
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 24 17 49
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 30 46 15
ND5 (size: 1821 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (4.46%)
Alanine (Ala, A)
n = 43 (7.1%)
Serine (Ser, S)
n = 50 (8.25%)
Threonine (Thr, T)
n = 53 (8.75%)
Cysteine (Cys, C)
n = 4 (0.66%)
Valine (Val, V)
n = 13 (2.15%)
Leucine (Leu, L)
n = 86 (14.19%)
Isoleucine (Ile, I)
n = 63 (10.4%)
Methionine (Met, M)
n = 42 (6.93%)
Proline (Pro, P)
n = 26 (4.29%)
Phenylalanine (Phe, F)
n = 48 (7.92%)
Tyrosine (Tyr, Y)
n = 19 (3.14%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 11 (1.82%)
Glutamic acid (Glu, E)
n = 11 (1.82%)
Asparagine (Asn, N)
n = 36 (5.94%)
Glutamine (Gln, Q)
n = 18 (2.97%)
Histidine (His, H)
n = 13 (2.15%)
Lysine (Lys, K)
n = 23 (3.8%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
24 39 38 12 14 45 6 9 17 1 2 5 6 0 15 33
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 3 1 4 15 23 1 3 10 14 0 4 12 10 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 27 1 8 15 15 0 1 11 7 12 0 0 9 27 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 9 2 4 7 22 1 1 4 3 0 0 0 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
105 142 229 131
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
63 160 132 252
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 235 251 105
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (14.86%)
Alanine (Ala, A)
n = 6 (3.43%)
Serine (Ser, S)
n = 12 (6.86%)
Threonine (Thr, T)
n = 8 (4.57%)
Cysteine (Cys, C)
n = 1 (0.57%)
Valine (Val, V)
n = 23 (13.14%)
Leucine (Leu, L)
n = 19 (10.86%)
Isoleucine (Ile, I)
n = 17 (9.71%)
Methionine (Met, M)
n = 11 (6.29%)
Proline (Pro, P)
n = 3 (1.71%)
Phenylalanine (Phe, F)
n = 13 (7.43%)
Tyrosine (Tyr, Y)
n = 10 (5.71%)
Tryptophan (Trp, W)
n = 4 (2.29%)
Aspartic acid (Asp, D)
n = 4 (2.29%)
Glutamic acid (Glu, E)
n = 9 (5.14%)
Asparagine (Asn, N)
n = 3 (1.71%)
Glutamine (Gln, Q)
n = 1 (0.57%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 4 (2.29%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 1 6 0 0 2 0 6 0 1 11 2 2 8 13 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 0 4 0 0 2 7 1 5 13 3 0 0 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 1 1 4 1 1 1 5 0 9 1 1 11 3 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 4 5 4 0 2 2 1 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 7 48 53
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 24 32 83
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
50 6 33 87
Total protein-coding genes (size: 11403 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 214 (5.63%)
Alanine (Ala, A)
n = 251 (6.61%)
Serine (Ser, S)
n = 275 (7.24%)
Threonine (Thr, T)
n = 314 (8.27%)
Cysteine (Cys, C)
n = 22 (0.58%)
Valine (Val, V)
n = 174 (4.58%)
Leucine (Leu, L)
n = 592 (15.59%)
Isoleucine (Ile, I)
n = 344 (9.06%)
Methionine (Met, M)
n = 259 (6.82%)
Proline (Pro, P)
n = 194 (5.11%)
Phenylalanine (Phe, F)
n = 241 (6.35%)
Tyrosine (Tyr, Y)
n = 133 (3.5%)
Tryptophan (Trp, W)
n = 104 (2.74%)
Aspartic acid (Asp, D)
n = 68 (1.79%)
Glutamic acid (Glu, E)
n = 95 (2.5%)
Asparagine (Asn, N)
n = 166 (4.37%)
Glutamine (Gln, Q)
n = 89 (2.34%)
Histidine (His, H)
n = 95 (2.5%)
Lysine (Lys, K)
n = 98 (2.58%)
Arginine (Arg, R)
n = 63 (1.66%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
168 176 208 65 99 268 41 102 82 7 29 46 80 19 95 146
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
51 10 12 44 89 111 6 25 66 91 32 36 71 80 7 56
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
82 164 12 49 67 100 4 15 40 63 70 6 17 45 121 31
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
64 76 19 32 36 91 7 3 18 40 2 1 0 7 0 98
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
801 914 1237 846
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
459 978 751 1610
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
230 1203 1599 766

>NC_020713.1 Hippotragus niger isolate ZA4143 mitochondrion, complete genome
GTTAATGTAGCTTAAATAAAGCAAGGCACTGAAAATGCCTAGATGAGTACATCATACTCCATAAACATAT
AGGTTTGGTCCCAGCCTTCCTGTTAGCTCTCAATAGACCTACACATGCAAGCATCCACGCCCCGGTGAGA
ATGCCCTCTAAGTCAACCAGACTATGAGGAGCGGGTATCAAGCACACTACTAGTAGCTCATGACACCTTG
CTTAGCCACACCCCCACGGGAAACAGCAGTGATAAAAATTAAGCCATGAACGAAAGTTTGACTAAGCCAT
ATTGACTAGGGTTGGTAAATCTCGTGCCAGCCACCGCGGTCATACGATTAACCCAAGTTAACAGGAATAC
GGCGTAAAACGTGTTAAAGCGCCACATCAAATAGAGTTGAGTTTTAATTAAACTGTAAAAAGCCATAATT
ATAATAAAAATAAACGACGAAAGTAACTCTACAACAGCTGACACACTATAGCTAAGACCCAAACTGGGAT
TAGATACCCCACTATGCTTAGCCCTAAACATAAATAATTATAAAAACAAAATTATTCGCCAGAGTACTAC
CGGCAACGGCCCAAAACTCAAAGGACTTGGCGGTGCTTTATACCCTTCTAGAGGAGCCTGTTCTGTAATC
GATAAACCCCGATAAACCTCACCAATCCTTGCTAATACAGTCTATATACCGCCATCTTCAGCAAACCCTA
AAAAAGGAATAAAAGTAAGCATAATCATTACACATAAAAACGTTAGGTCAAGGTGTAACCTATGGAATGG
GAAGAAATGGGCTACATTTTCTAATTCAAGAAAACCCACACGAAAGTTATTATGAAACTAATAACCAAAG
GAGGATTTAGCAGTAAGCTAAGAATAGAGTGCTTAGCTGAACCAGGCCATGAAGCACGCACACACCGCCC
GTCACCCTCCTCAAGTAATTACATGCACCTAAACTTATTACACGCATCAACAATATGAGAGGAGACAAGT
CGTAACAAGGTAAGCATACTGGAAAGTGTGCTTGGACAAACCAAAACATAGCTTAAATAAAGCATCTAGT
TTACACCTAGAAGATTTCATACCATATGAATGTTTTGAACCACACCTAGCCCAAACTTCCACTTTCTAGT
ATAACAACCAGAACAAAATAAAATAAAACATTTATTTCAATTTAAAGTATAGGAGATAGAAATTCTAAAT
ATGGCGCTATAGAAAAAGTACCGTAAGGGAACGATGAAAGAGAAAGTCAAAGTACAAAAAAGCAAAGATT
AACCCTTGTACCTTTTGCATAATGAGTTAACGAGCAAAAAACTTAACAAAGCGAACTTTAGCTAAGTAAC
CCGAAACCAGACGAGCTACTTACGGACAGTTTACCAGAACCAACTCATCTATGTGGCAAAATAGTGAGAA
GATCCATAAGTAGAGGTGACACGCCTAACGAGCCTGGTGATAGCTGGTTGTCCAGGAAATGAATCTTAGT
TCAGCTTTAAAGATACCAAAAATACAAACAGATCCCACTGTATCTTTAAAAGCTAGTCTAAAAGGGTACA
GCCTTTTAGAAACGGGTACAACCTTCACTAGAGAGTAAAATTTAACAACACCATAGTAGGCCTAAAAGCA
GCCATCAATTAAGAAAGCGTTAAAGCTCAACAATAACAACGATATTGATCCCAGCAGTAAACAATCAACT
CCTAGCCATAATACTGGACTATTCTATAACAAAATAGAAGCAATAATGTTAATATGAGTAACAAGAAATA
TTTTCTCCCCGCACAAGTTTAAATCAGTACCTGATAGTATACTGATTATTAACAGTAGATCAATATAACC
CAACAATTAATAGCTTATCAATCTTACTGTTAATCCGACACAGGAGTGCACTCAGGAAAGATTCAAAGAA
GTAAAAGGAACTCGGCAAACACAAACCCCGCCTGTTTACCAAAAACATCACCTCCAGCATTCCCAGTATT
GGAGGCACTGCCTGCCCAGTGACAAACGTTAAACGGCCGCGGTATTCTGACCGTGCAAAGGTAGCATAAT
CATTTGTTCTCTAAATAAGGACTTGTATGAATGGCCACACGAGGGTTTTACTGTCTCTTACTTCCGATCA
GTGAAATTGACCTCCCCGTGAAGAGGCGGGGATGAACTAACAAGACGAGAAGACCCTATGGAGCTTCAAC
TAACTAATCCAAAGAAAACAAACTCAATCACCAAGAGATAAAAACACTCTTTATGGGTTAGCAGTTTCGG
TTGGGGTGACCTCGGAGAATAAAAAATCCTCCGAGCGATTTTAAAGACTAGACCTACAAGTCAAACCAAA
TTATCGCTTATTGATCCAAATATTTGATCAACGGAACAAGTTACCCTAGGGATAACAGCGCAATCCTATT
CAAGAGTCCATATCGACAATAGGGTTTACGACCTCGATGTTGGATCAGGACATCCCGATGGTGCAGCCGC
TATCAAAGGTTCGTTTGTTCAACGATTAAAGTCCTACGTGATCTGAGTTCAGACCGGAGCAATCCAGGTC
GGTTTCTATCTGTTATGTATTTCTCCCAGTACGAAAGGACAAGAGAAATGGGGCCAACTTCAATAAAGCG
CCCCAGACCAATTAATGACCTTATCTCAATTAACCTCACAGACAACTCCCGCCCTAGAAAAGGGCCCAGT
TAAGGTGGCAGAGCCCGGTAATTGCGTAAAACTTAAACCTTTATACTCAGAGATTCAAATTCTCTCCTTA
ACAAATGTTCATAATTAATACCCTTATACTAATCATCCCCATCCTCCTAGCCGTAGCCTTCCTTACACTA
GTCGAACGAAAAATCCTAGGCTACATACAATTTCGAAAAGGCCCAAATGTCGTAGGCCCGTACGGCCTAC
TTCAACCCATCGCCGATGCAATTAAACTTTTCACTAAAGAACCCTTACGACCCGCCACATCCTCTATTTC
AATATTCATTCTAGCACCCATTCTAGCCCTAAGCCTAGCCCTAACCATATGAATTCCCCTGCCCATGCCC
TACCCACTCATTAACATAAACTTAGGAGTCCTTTTTATATTAGCCATGTCAAGCCTAGCCGTATACTCAA
TCCTCTGATCAGGCTGAGCTTCCAACTCAAAATACGCCCTCATCGGAGCCCTACGAGCAGTAGCACAAAC
AATCTCATATGAAGTAACACTAGCAATTATCCTATTATCAGTATTACTAATAAACGGATCCTTCACTCTT
TCCACATTAATTATCACACAAGAACAAATATGACTAATCTTCCCAGCATGACCCCTAGCAATAATATGAT
TTATCTCAACACTAGCAGAAACAAACCGAGCACCATTTGACCTCACCGAAGGAGAATCAGAACTGGTCTC
AGGCTTTAACGTGGAATACGCAGCAGGGCCCTTCGCCCTATTTTTTATAGCAGAATATGCTAACATCATC
ATAATAAATGTCTTCACAACAACCCTATTCCTGGGAGCATTTCACAGCCCGTACATACCAGAACTTTACA
CTATCAACTTTACCATTAAATCTTTACTACTCACAATTACCTTCTTATGAATTCGAGCATCCTACCCGCG
ATTCCGCTATGACCAATTAATACACTTATTATGAAAAAACTTTCTGCCCCTAACACTAGCCCTATGCATA
TGGCACGTCTCCATGCCCATTCTCCTATCAGGCATCCCCCCGCAAACATAAGAAATATGTCTGACAAAAG
AGTTACTTTGATAGAGTAAATAATAGAGGTCTAAACCCTCTTATTTCTAGAACTATAGGAATTGAACCTA
ATCCTAAGAACCCAAAACTCTTCGTGCTCCCAATTACACCAAATTCTAACAGTAAGGTCAGCTAATTAAG
CTATCGGGCCCATACCCCGAAAATGTTGGTTCATATCCTTCCCATACTAATAAACCCAATTATCTCTATT
ATCATCCTAACAACCATCATATTCGGAACCATTATCGTTATAATTAGCTCACACTGATTACTCATCTGAA
TTGGATTCGAGATAAATACACTTGCTATTATCCCCATTATAATAAAAAAATATAACCCACGAGCCACAGA
AGCATCAACCAAATATTTCCTAACTCAATCAACAGCTTCCATACTACTAATAATAGCTGTTATCATCAAC
TTAATATCCTCCGGCCAATGAACTGTAATAAAACTGTTTAACCCAACAGCCTCCATACTCATAACAATAG
CCCTCACTATAAAATTAGGAATAGCTCCTTTCCACTTCTGAGTCCCAGAAGTAACACAAGGCATCTCCCT
GCACTCAGGCCTAATTCTACTTACATGACAAAAACTAGCACCCATATCAGTACTCTACCAAATCTCCCCA
TCCATTAACCTAAACCTAATCATAACCCTATCAATCCTATCAATCATGGTAGGAGGCTGGGGAGGACTAA
ATCAAACCCAACTACGAAAAATTATAGCCTACTCATCAATCGCCCACATGGGCTGAATAACAGCAGTACT
ACCATACAACCCCACTATAACATTACTAAACTTAATCATCTACATCATCATAACCACCGCCATATTTACA
CTATTTATAGCCAACTCAACCACAACTACCTTATCACTATCCCATACATGAAATAAAGCACCTATCATAA
CTGCCTTAGCCCTCATTACCCTTCTATCAATAGGAGGACTCCCCCCACTTTCAGGGTTTATACCAAAATG
AATGATCATCCAAGAGATAACAAAAAACGATAATATTATCCTACCCACCCTCATGGCAATCACAGCACTA
TTAAACCTATATTTCTACATACGACTTACCTACTCTACCGCACTTACAATATTTCCCTCCACAAATAACA
TAAAAATAAAATGACAGTTTTCTATCACAAAACAAATAACCCTCCTACCAACAATAGTAGTATTATCCAC
TATACTTCTACCACTCACACCAATCCTATCAGTCCTAGAATAGGAGTTTAGGTTAAACAGACCAAGAGCC
TTCAAAGCCCTAAGCAAGTATAATTTACTTAATTCCTGACAAGGACTGCAAGACTATATCTTACATCAGC
TGAATGCAAACCAACCACTTTAATTAAGCTAAGTCCTCACTAGATTGGTGGGCTCCACCCCCACGAAACT
TTAGTTAACAGCTAAACACCCTAAACAACTGGCTTCAATCTACTTCTCCCGCCGCGAGAAAAAAAAGGCG
GGAGAAGCCCCGGCAGAATTGAAGCTGCTTCTTCGAATTTGCAATTCAATATGTTAATTCACTACAGAGC
TTGGTAAAAAGAGGAATTAAACCTCTGTCCTTAGATTTACAGTCTAATGCTTCACTCAGCCATCTTACCC
ATGTTCATCAACCGCTGACTATTTTCAACTAACCATAAAGATATCGGCACCCTATACCTCCTATTCGGTG
CTTGAGCTGGCATGGTAGGGACCGCCCTAAGCCTACTAATTCGCGCTGAGTTAGGCCAACCTGGAACCTT
ACTTGGGGATGACCAGATCTACAACGTAGTCGTAACCGCACATGCATTCGTAATAATTTTCTTTATAGTA
ATACCCATTATAATTGGAGGGTTTGGCAACTGATTAGTTCCTTTAATAATTGGAGCCCCCGACATGGCAT
TCCCTCGAATAAACAATATAAGCTTTTGACTGCTTCCCCCTTCCTTTCTGTTACTCCTAGCATCCTCTAT
GGTTGAAGCAGGAGCAGGAACAGGCTGAACCGTATACCCCCCTCTAGCAGGCAACCTAGCCCATGCAGGA
GCCTCAGTGGATCTCACCATTTTCTCTCTACACCTAGCAGGTGTTTCCTCAATTCTAGGGGCCATCAACT
TTATTACAACAATTATTAACATAAAACCCCCTGCAATAACACAATATCAAACACCCTTATTCGTGTGATC
CGTATTAATTACTGCCGTATTACTACTCCTATCACTCCCTGTACTAGCAGCCGGCATTACAATACTACTA
ACGGACCGAAATCTAAATACTACCTTCTTTGATCCAGCAGGAGGAGGAGATCCTATCCTATATCAGCACC
TATTCTGATTTTTTGGCCACCCTGAAGTATATATTCTTATTCTACCCGGATTCGGAATAATTTCTCACAT
CGTGACCTATTATTCAGGGAAAAAAGAACCATTCGGGTACATGGGAATAGTATGAGCTATAATATCAATC
GGGTTCCTAGGGTTTATCGTATGGGCTCATCACATATTTACAGTCGGCATAGACGTCGATACACGAGCCT
ACTTCACATCAGCCACCATAATTATTGCTATCCCAACCGGAGTAAAAGTCTTCAGCTGATTAGCAACACT
TCATGGGGGTAACATTAAATGATCTCCCGCTATAATATGAGCCCTAGGCTTCATTTTCCTCTTCACAGTT
GGGGGCCTAACCGGAATTGTCCTAGCCAATTCTTCCCTCGACATTGTTCTTCACGATACATATTATGTAG
TCGCACATTTCCACTACGTATTATCAATAGGAGCCGTATTCGCTATCATAGGAGGGTTCGTACATTGATT
TCCCTTATTCTCAGGTTATACTCTAAACATAACATGAGCCAAAATCCACTTCGCAATTATATTTGTAGGC
GTAAACATAACTTTCTTCCCACAACATTTCTTAGGCTTATCTGGCATGCCACGACGATACTCTGATTACC
CAGACGCATACACAATATGAAACACTATCTCATCTATGGGTTCATTTATTTCACTAACAGCGGTAATACT
AATAGTTTTCATCATCTGAGAGGCATTCGCATCCAAACGGGAAGTCCTAACTGTGGACCTAACTACAACA
AATCTAGAGTGACTAAACGGATGTCCCCCACCATATCACACATTTGAAGAACCCACATATGTCAACCTAA
AATAAGAAAGGAAGGAGTCGAACCCCCTACAATTGGTTTCAAGCCAACACCATAACCACTATGTCTTTCT
CAATTACGAGAGGTTAGTAAAACATTACATAATCTTGTCAAGATTAAATTACAGGTGAAAGTCCCGTACA
TCTCATATGGCATACCCCATACAACTAGGATTTCAAGATGCAACATCACCTATCATAGAAGAACTGTTAC
ATTTCCACGACCATACACTAATGATCGTCTTTCTGATTAGCTCATTGGTACTTTATATTATCTCGCTAAT
ATTAACAACAAAATTAACTCATACTAGTACTATAGATGCACAAGAAGTAGAGACAATCTGAACCATCCTA
CCAGCTATTATCTTGATTATAATCGCCCTCCCGTCTTTACGAATTCTATACATAATGGACGAAATCAACA
ACCCATCTCTTACAGTAAAAACTATAGGACATCAGTGATACTGAAGCTACGAATACACGGATTATGAAGA
CCTAAGCTTCGACTCCTATATAATTCCAACATCAGAATTAAAACCAGGGGAACTGCGACTACTAGAAGTA
GACAATCGAGTCGTGTTACCCATAGAAATAACAATTCGAATACTAATCTCTTCCGAAGACGTATTGCACT
CATGAGCAGTGCCCTCTTTAGGACTGAAAACGGACGCAATTCCAGGCCGCCTAAACCAAACAACCCTTAT
ATCAACCCGACCAGGACTATACTACGGTCAATGCTCAGAAATCTGTGGGTCAAATCACAGCTTTATGCCA
ATTGTCCTCGAACTAGTCCCACTAGAATATTTTGAAAAATGATCTGCATCAATACTATAAAATCATCAAG
AAGCTATGTCAGCGTTAACCTTTTAAGTTAAAGATCGGGGGTATAACTCTCCTTGATGACATGCCACAAC
TAGATACATCAACATGACTTACAATAATCCTGTCTATATTCCTAGTCCTTTTCATCATTTTCCAATTAAA
AATCTCAAAACATAACTTCTACCACAACCCAGAACCAACATGAATGAAAATACCAAAGCAAGACAACCCC
TGAGAAACAAAATGAACGAAAATCTATTTGCCTCTTTCATTACCCCTATAATTCTAGGCCTCCCCCTTGC
CACCCTAATTGTCTTATTTCCCAGCTTACTATTCCCTACATCAGATCGCCTAATTAACAATCGCCTCATC
TCTCTCCAACAATGAATTCTCCAACTCGTATCAAAGCAAATAATAAACATTCACAATACCAAAGGACAAA
CATGAACATTAATACTAATATCCCTAATTTTGTTTATTGCATCAACAAATCTACTAGGCCTGTTACCCCA
CTCATTTACACCAACTACACAACTATCAATAAACTTAGGCATGGCTATTCCCTTATGAGCAGGGGCTGTA
ATTACAGGTTTTCGCAGTAAAACTAAAGCATCACTTGCCCATTTCTTACCACAAGGAACACCAACCCCAC
TAATCCCAATACTAGTAATTATTGAGACTATTAGTCTTTTTATCCAACCAATAGCCCTTGCTGTACGACT
AACAGCTAACATCACAGCAGGCCACCTACTAATTCACTTAATTGGAGGAGCCACCCTCGCACTAATGAGT
ATCAACACCGCAACAGCCCTTATTACATTTATTATCCTGATTCTACTAACAGTCCTCGAATTTGCAGTAG
CTATCATTCAAGCTTATGTATTTACTCTCTTAGTTAGCCTATACCTGCATGATAACACATAATGACACAC
CAAACGCATGCTTACCACATAGTAAACCCAAGCCCCTGACCCCTTACAGGAGCACTATCTGCCCTCCTAA
TAACATCTGGCTTAATTATATGGTTCCACTTCAATTCAACAACCCTGTTAATGCTCGGCCTAACAACAAA
CACACTAACAATATATCAATGATGACGAGATATTATCCGAGAGAGTACATTTCAAGGCCACCATACTCCT
GCCGTCCAAAAAGGCCTTCGCTACGGAATAATCTTATTTATCATCTCAGAAGTTTTATTCTTTACCGGAT
TTTTCTGAGCTTTTTATCACTCAAGTCTTGCTCCCACACCCGAACTAGGCGGCTGTTGACCCCCGACAGG
CATTCACCCACTCAATCCCCTAGAAGTCCCACTACTCAACACTTCTGTTCTCTTAGCCTCAGGAGTCTCA
ATTACCTGAGCCCACCATAGCCTCATAGAAGGAAACCGCAATAACATATTACAAGCCCTATTCATCACTA
TTGCCCTAGGTGTCTACTTCACACTACTGCAAGCCTCAGAATATTATGAAGCACCTTTTACTATCTCAGA
TGGAGTCTATGGCTCAACCTTCTTCGTAGCCACGGGATTCCACGGCCTCCATGTAATCATTGGATCCACC
TTCTTAATCGTCTGCTTCTTCCGCCAACTAAAATTCCACTTTACCTCTAGCCACCACTTTGGCTTTGAAG
CTGCTGCCTGATATTGACATTTCGTAGACGTAGTATGACTTTTCCTCTATGTCTCTATCTATTGATGAGG
ATCATATTCTTTTAGTATCAACCAGTACAACTGACTTCCAATCAGTTAGTTTCGGTCTAATCCGAAAAAG
AATAATAAACCTTGTAGTAGCCCTTCTAACCAACCTCACACTAACTACACTACTCGTCATCATTGCATTC
TGACTTCCCCAGTTAAATGTGTACTCAGAAAAAACAAGCCCATACGAGTGCGGATTTGATCCCATGGGAT
CCGCCCGCCTCCCTTTCTCTATAAAATTTTTCCTAGTAGCCATTACATTCCTCCTTTTCGACTTAGAAAT
TGCATTACTCCTACCACTACCATGAGCCTCACAAACAACTAACCTAAACACAATACTCACCATAGCCCTC
CTCCTAATCTTCCTACTAGCTGCCAGCCTGGCCTATGAATGAACCCAAAAAGGATTAGAGTGAACTGAAT
ATGGTACTTAGTTTAAAACAAAAATAAATGATTTCGACTCATTAGATTATGATTAAACTCATAATTACCA
AATGTCCCTCGTACATATAAACATCATAATAGCATTTGCAGTATCTCTTACAGGACTACTAATATATCGA
TCCCACCTAATATCCTCCCTTTTATGCCTAGAAGGAATGATATTATCCCTATTCATTATGGCCACCCTAA
CAATCCTAAACTCACACTTCACCCTGGCCAGCATGATACCCATCATTCTACTGGTATTCGCAGCTTGTGA
AGCAGCACTGGGTCTATCCCTACTAGTAATGGTATCAAACACATATGGTACTGATTACGTACAAAACCTC
AACTTATTACAATGCTAAAATACATTATCCCCACAATAATGCTTATACCCCTAACCTGATTATCAAAAAA
TAACATACTATGAATTAACCCCACACTTCACAGCCTACTAATTAGCCTCACAAGTCTGCTCCTTATAAAC
CAATTCAACGATAATAGTCTCAATTTTTCACTGATCTTCTTTTCTGATCCTTTATCCATACCACTGCTGA
TTCTTACTATATGACTCCTCCCTCTAATGCTGATAGCCAGCCAACACCACCTATCAAAAGAAAACCTAAC
TCGAAAAAAACTATATATCTCTATACTAATTCTATTACAATTATTCCTAATCATAACATTCACTGCTACA
GAGCTAATCTTCTTTTACATCCTATTCGAAGCCACACTAATTCCAACACTCATCATTATTACCCGATGAG
GAAATCAAACAGAACGTCTAAACGCCGGTCTTTACTTCCTGTTTTACACACTAGCAGGATCCCTACCCCT
ACTAATTGCACTGATCTATGTTCAAAACACAATAGGGTCCCTAAACTTCCTAATCCTCCAATATTGAGTC
CAACCAATATTCAACTCCTGATCCAACGTTTTCACGTGGCTAGCGTGCATAATAGCCTTCATAGTAAAAA
TACCACTATATGGCCTCCACCTTTGACTGCCTAAAGCCCATGTAGAAGCTCCCATTGCAGGCTCTATAGT
CCTAGCAGCAATTTTACTAAAACTAGGAGGATATGGCATATTACGAATTACATTAATTCTAAGCCCAATA
ACCAACTTCATAGCATATCCTTTTATTATACTATCTCTATGAGGCATAATCATGACTAGCTCAATTTGTC
TCCGCCAAACGGACCTAAAATCACTCATTGCATACTCCTCCGTCAGCCACATAGCACTTGTTATCGTGGC
TATTCTTATCCAAACACCTTTAAGTTATACAGGAGCCATCGCTCTAATGATTGCCCATGGTCTTACATCC
TCTATGCTCTTCTGCCTAGCAAACTCTAACTACGAACGAATCCACAGCCGCACAATAATTCTAGCCCGCG
GCTTACAAACACTCCTCCCACTCATAGCAACCTGATGACTCCTAGCGAGCCTAACCAACCTAGCTCTACC
CCCAACAATTAACCTGATCGGAGAATTATTCGTAGTAATATCAACCTTCTCGTGATCCAACGCTACAATT
ATCTTAGTAGGACTTAACATAGTAATCACCGCCCTATACTCCCTCTACATATTAATTACAACACAACGAG
GCAAATATACTCACCATATTAACAACATCTCACCTTCCTTTACACGAGAGAATGCACTCATATCACTACA
CATACTACCACTACTACTACTATCCTTAAACCCAAAGATTATCCTAGGCCCTTTGTACTGTAAATATAGT
TTAAAAAAACGCTAGACTGTGAATCTAACAATAGAAGCCCATTGCCTTCTTATTTACCGAAAAAGTATGC
AAGAACTGCTAATTCTGCGCCTCCATGCCTAACAACATGGCTTTTTCAAACTTTTAAAGGATAGCAGTTA
TCCGTTGGTCTTAGGAATCAAAAAATTGGTGCAACTCCAAATAAAAGTAATAAACATATTCTCCTCCTTC
ACATTAACAACTCTATTTCTACTAACCATGCCCATCATAATAGCAAGCCCCAATACCCACAAAACCTCCA
ACTACCCATTCTACGTAAAAACAACTATTTCATATGCCTTCATCACCAGTATAATCCCCACAATAATATT
CATCCACACAGGACAAGAAATAATTATCTCAAACTGACACTGATTAACTATTCAAACCCTCAAACTATCA
CTCAGCTTCAAAATAGACTACTTCTCAATAATATTTGTCCCAGTAGCACTATTCGTCACATGATCCATCA
TAGAATTCTCAATATGATACATACACTCAGACCCCAACATTAACCAATTTTTCAAATATCTACTCCTATT
CCTCATTACTATGCTAATCCTTGTCACCGCAAACAACCTCTTTCAACTATTCATCGGCTGAGAAGGAGTC
GGAATCATATCATTCCTACTCATTGGATGATGATACGGACGAGCAGATGCAAACACAGCGGCCCTACAAG
CAATCCTGTATAACCGCATTGGCGACATTGGATTTATCCTAGCAATAGCATGATTCCTAGCTAACCTCAA
TACCTGAGACCTCCAACAAATCTTTATACTAAAACCAAATGATTCAAATCTACCCCTAATAGGCCTAGTA
CTTGCTGCAACAGGAAAATCCGCACAATTCAGCCTACACCCATGACTACCCTCCGCAATAGAAGGTCCAA
CCCCTGTCTCAGCATTACTTCACTCAAGCACAATAGTAGTAGCAGGCATTTTTCTATTAATCCGTTTCTA
CCCACTAACAGAAAACAACAAATTTGCCCAATCCGTTATATTATGTCTAGGAGCTATCACCACATTATTC
ACAGCAATATGTGCCCTCACCCAAAATGATATCAAAAAAATCATTGCCTTTTCCACATCCAGCCAACTAG
GCCTTATAATAGTAACAATCGGCATTAACCAACCCTACCTGGCATTCCTTCATATCTGTACTCACGCCTT
TTTCAAAGCTATGCTATTTATATGCTCTGGCTCTATTATTCATAGCCTAAACGACGAGCAGGACATCCGA
AAAATAGGAGGCCTATTCAAAGCAATACCATTTACCACAACAGCCCTCATTATTGGCAGCCTCGCACTCA
CAGGAATACCTTTCCTTACCGGATTCTACTCCAAAGACCTAATCATTGAATCTGCCAACACGTCTTATAC
CAACGCCTGAGCCCTTCTAATAACACTAATCGCCACCTCTTTCACAGCCATCTACAGCACACGCATCATT
TTCTTTGCACTACTTGGACAACCTCGATTCTCAACCCTTATCTCCATTAACGAAAATAACCCCTTCCTAT
TAAATTCAATCAAACGCCTGCTGATTGGAAGCCTTTTCGCAGGATTCATTATCTCCAACAATATTCCCCC
AACAACAATCCCTCAAATAACCATACCCTACTACCTAAAAATAACAGCCCTAGCAATCACAATCTTAGGT
TTTATCCTAGCACTAGAAATTAACAACATAACCCACAACCTAAAATTCAACCACCCATCAAACGCCTTTA
AATTCTCCAACCTACTAGGTTATTACCCCACAATTATACACCGCCTAACTCCCTATATAAACCTAACAAT
AAGCCAAAAATCAGCATCCTCTCTCCTAGATCTGATCTGACTGGAAGCCATCCTACCAAAAACCATCTCA
TCTATCCAAATAAAAGCATCCGTTATAATTACAAACCAAAAAGGCCTAATCAAGTTATATTTCCTCTCTT
TCCTAATCACCATCCTTATCAGCATGATCCTACTTAATTTCCACGAGTAATCTCTATAATAACCACAACA
CCAATCAACAAAGATCAACCAGTTACAATAACTAGTCAAGTACCATAACTATACAAAGCCGCAATTCCTA
TAGCTTCCTCACTAAAAAACCCGGAATCCCCAGTATCATAAATGACTCAATCCCCCAACCCATTAAACTT
AAACACAATTTCAACCTCTTCATCTTTTAGCACATAATAAACCATCAAAAACTCTATCAACAACCCAGTG
ATAAACGCTCCTAAAACAACCTTACTAGAAACCCAAACTTCAGGATACTGCTCAGTAGCCATAGCCGTTG
TATAGCCAAAAACCACTATCATTCCTCCTAAATAAATTAAAAAGACCATCAACCCCAAAAAAGACCCACC
AAAATTCAACACAATACCACACCCAACCCCACCACTCACAATTAACCCTAACCCCCCATAAATAGGTGAA
GGTTTCGAAGAAAACCCCACAAAACCAATCACAAAAATAATACTCAAAATTAATACAATGTATATTATCA
TTATTCTCGCATGGAATCTAACCACGACTAATGATATGAAAAACCATCGTTGTCATTCAACTACAAGAAC
ATCAATGATCAATATCCGAAAAACTCACCCACTGATAAAAATTGTAAACAACGCATTCATTGACCTCCCA
ACCCCACCAAATATCTCATCGTGATGAAACTTCGGCTCCCTCCTAGGTATCTGCTTAATTCTACAAATCC
TGACGGGCCTATTCCTAGCAATACACTACACATCCGACACGATAACAGCATTCTCCTCTGTCACTCATAT
TTGCCGAGATGTCAACTACGGCTGAATCATTCGATACATACACGCAAACGGGGCATCAATATTCTTCATC
TGCCTATTCATGCATGTAGGACGAGGCCTCTATTACGGATCATACACCTTCCTAAAAACATGAAACATCG
GAGTAATTCTCTTATTCACAACAATAGCTACAGCATTCATAGGCTATGTCCTGCCATGAGGACAAATATC
ATTCTGAGGAGCAACAGTCATCACTAATCTCCTCTCAGCAATCCCATATATCGGCACAAACCTAGTCGAA
TGAATCTGAGGGGGATTCTCCGTAGACAAAGCAACCCTCACCCGATTCTTTGCTTTCCACTTTATTCTCC
CTTTTATCATTACTGCCCTCGCCATAGTACACCTACTCTTTCTTCACGAAACAGGCTCCAACAACCCCAC
AGGAATTTCATCAGACGCAGACAAAATCCCGTTCCATCCTTACTATACTATTAAAGACATCCTAGGTGCC
CTACTACTAATCTTAGCCCTCATATTACTAGTACTGTTCGCACCCGACCTACTTGGAGACCCAGATAACT
ACACCCCAGCRAACCCACTCAATACACCCCCTCACATCAAGCCCGAATGATATTTCTTATTTGCATACGC
AATCCTCCGATCAATTCCCAATAAACTAGGAGGAGTTCTAGCCCTAATCTTCTCAATTCTAATTCTAGTA
CTTATACCTGCACTCCATACATCCAAACAACGAAGCATGATATTCCGGCCAATCAGCCAATGTATCTTCT
GAATCTTAGTGGCAGACTTACTAACACTCACATGAATTGGAGGACAACCAGTTGAACACCCATATATTAT
TATCGGACAATTAGCATCTATCATATACTTCCTACTCATCCTAGTGCTAATACCAATGGCCGGTTCTATC
GAAAACAAACTCCTAAAATGAAGACAAGTCTTTGTAGTACACTGAATACACTGGTCTTGTAAACCAGAAA
AGGAGAGCAACACCTCCCTAAGACTCAAGGAAGAAGCTATAGCCACACTATCAACACCCAAAGCTGAAGT
TCTATTTAAACTATTCCCTGAAGCGCTATCATTATACCTCCACAAATATCAAGAGCCTTCTCCGCATTAA
ATTTACCAAAAATTCCAAAAACCCCACACAAACTTTACACTCCACAACCCACACACAAGATAACCCCATT
AAACATACCGCACTACACTACTCATCCACACATACATGAACTTATATACGTACATACTACTGAAAGCAAC
AAGTACACAACACATCAAATGGTCTATCTTATATATGTGAGTAGTACATGTATGGTTAAATGTGCTACGG
ACATGCATGTACGTGGTACATCGCATGGCTTATTCCACGCATGTGGGCTAGACGTACATACAGTCAATGT
ACCACAGACATAATATGTATATAGTACATTAAATGATTTGCCCCATGCATATAAGCAAGTACATTATATT
TTAACAGTACATAGGACATAGAATGCTTGATTGTACATAGCACATTTAAGTCAAATCCATTCTCGACAAC
ATGCATATCCCGACCATTAGATCACGAGCTTAATTACCATGCCGCGTGAAACCAGCAACCCGCTTGGCAG
GGATCCCTCTTCTCGCTCCGGGCCCATTGATTGTGGGGGTCGCTAATGAATGAACTTTATCAGACATCTG
GTTCTTTCTTCAGGGCCATCTCATCTAAAATCGCCCACTCTTTCCCCTTAAATAAGACATCTCGATGGAC
TAATGACTAATCAGCCCATGCTCACACATAACTGTGGTGTCATACATTTGGTATTTTTTAATTTTTGGGG
ATGCTTGGACTCAGCTATGGCCGTCTGAGGCCCTGACCCGGAGCATATATTGTAGCTGGACTTAACTGCA
CCTTGAGCCTCACCATAATGGTAAGCACGAGTATCAAAGTTAATGATCGTAAAGACATAAGCTGACATTA
AGCATGGATATTATAGTCAATGGTCACAGGACATAAATTACTATCTCCCCGGGACCCATCTACGACCCCC
TATATATATACCCCTATTTTTAACACACTCCCCCCAAGATGTGAATTTGAATTTGCTCTCTCCTCAATAC
TTAAATTAGCACTCCAGACAAGTAAGTATATAAGCACCTAAGCCATCATGGCATACA


Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.