Viewing data for Prionailurus bengalensis


Scientific name Prionailurus bengalensis
Common name Leopard cat
Maximum lifespan 17.00 years (Prionailurus bengalensis@AnAge)

Total mtDNA (size: 16990 bases) GC AT G C A T
Base content (bases) 6721 10269 4420 2301 4657 5612
Base content per 1 kb (bases) 396 604 260 135 274 330
Base content (%) 39.6% 60.4%
Total protein-coding genes (size: 11339 bases) GC AT G C A T
Base content (bases) 4533 6806 3123 1410 3197 3609
Base content per 1 kb (bases) 400 600 275 124 282 318
Base content (%) 40.0% 60.0%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1514 bases) GC AT G C A T
Base content (bases) 544 970 312 232 432 538
Base content per 1 kb (bases) 359 641 206 153 285 355
Base content (%) 35.9% 64.1%
Total rRNA-coding genes (size: 2529 bases) GC AT G C A T
Base content (bases) 1009 1520 564 445 586 934
Base content per 1 kb (bases) 399 601 223 176 232 369
Base content (%) 39.9% 60.1%
12S rRNA gene (size: 957 bases) GC AT G C A T
Base content (bases) 394 563 223 171 218 345
Base content per 1 kb (bases) 412 588 233 179 228 361
Base content (%) 41.2% 58.8%
16S rRNA gene (size: 1572 bases) GC AT G C A T
Base content (bases) 615 957 341 274 368 589
Base content per 1 kb (bases) 391 609 217 174 234 375
Base content (%) 39.1% 60.9%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 271 410 190 81 204 206
Base content per 1 kb (bases) 398 602 279 119 300 302
Base content (%) 39.8% 60.2%
ATP8 (size: 204 bases) GC AT G C A T
Base content (bases) 65 139 51 14 55 84
Base content per 1 kb (bases) 319 681 250 69 270 412
Base content (%) 31.9% 68.1%
COX1 (size: 1545 bases) GC AT G C A T
Base content (bases) 630 915 360 270 495 420
Base content per 1 kb (bases) 408 592 233 175 320 272
Base content (%) 40.8% 59.2%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 274 410 180 94 188 222
Base content per 1 kb (bases) 401 599 263 137 275 325
Base content (%) 40.1% 59.9%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 329 455 214 115 234 221
Base content per 1 kb (bases) 420 580 273 147 298 282
Base content (%) 42.0% 58.0%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 497 643 349 148 309 334
Base content per 1 kb (bases) 436 564 306 130 271 293
Base content (%) 43.6% 56.4%
ND1 (size: 956 bases) GC AT G C A T
Base content (bases) 417 539 296 121 246 293
Base content per 1 kb (bases) 436 564 310 127 257 306
Base content (%) 43.6% 56.4%
ND2 (size: 1042 bases) GC AT G C A T
Base content (bases) 376 666 287 89 273 393
Base content per 1 kb (bases) 361 639 275 85 262 377
Base content (%) 36.1% 63.9%
ND3 (size: 347 bases) GC AT G C A T
Base content (bases) 146 201 103 43 94 107
Base content per 1 kb (bases) 421 579 297 124 271 308
Base content (%) 42.1% 57.9%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 533 845 375 158 393 452
Base content per 1 kb (bases) 387 613 272 115 285 328
Base content (%) 38.7% 61.3%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 111 186 74 37 95 91
Base content per 1 kb (bases) 374 626 249 125 320 306
Base content (%) 37.4% 62.6%
ND5 (size: 1830 bases) GC AT G C A T
Base content (bases) 710 1120 511 199 520 600
Base content per 1 kb (bases) 388 612 279 109 284 328
Base content (%) 38.8% 61.2%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 202 326 154 48 112 214
Base content per 1 kb (bases) 383 617 292 91 212 405
Base content (%) 38.3% 61.7%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.87%)
Alanine (Ala, A)
n = 19 (8.41%)
Serine (Ser, S)
n = 14 (6.19%)
Threonine (Thr, T)
n = 22 (9.73%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (3.98%)
Leucine (Leu, L)
n = 43 (19.03%)
Isoleucine (Ile, I)
n = 26 (11.5%)
Methionine (Met, M)
n = 12 (5.31%)
Proline (Pro, P)
n = 13 (5.75%)
Phenylalanine (Phe, F)
n = 12 (5.31%)
Tyrosine (Tyr, Y)
n = 2 (0.88%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 11 (4.87%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 8 (3.54%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 4 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 13 10 4 3 17 5 12 8 1 2 1 5 1 8 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 3 13 3 0 0 3 6 2 5 3 4 1 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 5 1 3 1 6 0 2 2 1 1 1 2 6 5 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 3 0 1 0 4 0 0 2 2 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
43 63 79 42
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
22 64 39 102
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 63 88 60
ATP8 (size: 204 bases)
Amino acid sequence: MPQLDTSTWFITIMSMIMTLFIVFQLKISKYSYPSNPELKSTATLKQLNPWEKKWTKIYSPLSLPQQ*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 1 (1.49%)
Serine (Ser, S)
n = 8 (11.94%)
Threonine (Thr, T)
n = 7 (10.45%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.49%)
Leucine (Leu, L)
n = 8 (11.94%)
Isoleucine (Ile, I)
n = 6 (8.96%)
Methionine (Met, M)
n = 4 (5.97%)
Proline (Pro, P)
n = 6 (8.96%)
Phenylalanine (Phe, F)
n = 3 (4.48%)
Tyrosine (Tyr, Y)
n = 3 (4.48%)
Tryptophan (Trp, W)
n = 3 (4.48%)
Aspartic acid (Asp, D)
n = 1 (1.49%)
Glutamic acid (Glu, E)
n = 2 (2.99%)
Asparagine (Asn, N)
n = 2 (2.99%)
Glutamine (Gln, Q)
n = 5 (7.46%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 7 (10.45%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 2 3 3 0 5 0 0 3 2 0 0 1 0 2 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 1 0 0 0 0 0 0 0 1 2 3 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 4 1 1 0 6 1 0 0 1 2 0 0 1 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 0 0 1 6 1 0 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
5 19 26 18
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
3 22 21 22
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 10 37 15
COX1 (size: 1545 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.14%)
Alanine (Ala, A)
n = 40 (7.78%)
Serine (Ser, S)
n = 30 (5.84%)
Threonine (Thr, T)
n = 39 (7.59%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 38 (7.39%)
Leucine (Leu, L)
n = 61 (11.87%)
Isoleucine (Ile, I)
n = 35 (6.81%)
Methionine (Met, M)
n = 34 (6.61%)
Proline (Pro, P)
n = 28 (5.45%)
Phenylalanine (Phe, F)
n = 42 (8.17%)
Tyrosine (Tyr, Y)
n = 19 (3.7%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 15 (2.92%)
Glutamic acid (Glu, E)
n = 10 (1.95%)
Asparagine (Asn, N)
n = 17 (3.31%)
Glutamine (Gln, Q)
n = 6 (1.17%)
Histidine (His, H)
n = 18 (3.5%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
25 10 19 9 6 19 4 20 6 0 11 5 17 5 21 21
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
15 1 0 11 14 13 2 8 13 21 5 8 11 8 1 18
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 13 3 6 6 15 0 1 2 8 11 4 3 11 6 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 9 1 10 5 9 0 1 1 5 1 0 0 1 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
150 98 137 130
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 134 95 210
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
44 128 188 155
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.96%)
Alanine (Ala, A)
n = 8 (3.52%)
Serine (Ser, S)
n = 18 (7.93%)
Threonine (Thr, T)
n = 19 (8.37%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 11 (4.85%)
Leucine (Leu, L)
n = 34 (14.98%)
Isoleucine (Ile, I)
n = 19 (8.37%)
Methionine (Met, M)
n = 15 (6.61%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 7 (3.08%)
Tyrosine (Tyr, Y)
n = 11 (4.85%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 10 (4.41%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 6 (2.64%)
Glutamine (Gln, Q)
n = 7 (3.08%)
Histidine (His, H)
n = 7 (3.08%)
Lysine (Lys, K)
n = 5 (2.2%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 7 12 6 4 11 3 9 7 0 1 5 5 0 3 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 2 2 4 2 0 3 3 3 0 3 6 3 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 10 0 4 4 6 0 0 4 6 5 2 1 2 4 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 11 4 4 6 5 0 0 1 4 1 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
53 57 68 50
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 54 62 86
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 69 92 52
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 16 (6.15%)
Serine (Ser, S)
n = 21 (8.08%)
Threonine (Thr, T)
n = 23 (8.85%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 15 (5.77%)
Leucine (Leu, L)
n = 33 (12.69%)
Isoleucine (Ile, I)
n = 15 (5.77%)
Methionine (Met, M)
n = 9 (3.46%)
Proline (Pro, P)
n = 11 (4.23%)
Phenylalanine (Phe, F)
n = 22 (8.46%)
Tyrosine (Tyr, Y)
n = 13 (5.0%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 7 (2.69%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 8 7 5 5 15 1 7 5 2 5 3 7 0 9 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 2 5 8 3 0 1 5 12 2 3 2 6 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 9 0 3 6 8 0 2 2 9 4 2 0 3 4 8
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 7 1 0 3 3 0 0 1 4 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
62 65 61 73
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 67 57 94
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 82 103 66
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (6.86%)
Alanine (Ala, A)
n = 23 (6.07%)
Serine (Ser, S)
n = 27 (7.12%)
Threonine (Thr, T)
n = 25 (6.6%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 17 (4.49%)
Leucine (Leu, L)
n = 57 (15.04%)
Isoleucine (Ile, I)
n = 42 (11.08%)
Methionine (Met, M)
n = 14 (3.69%)
Proline (Pro, P)
n = 22 (5.8%)
Phenylalanine (Phe, F)
n = 25 (6.6%)
Tyrosine (Tyr, Y)
n = 16 (4.22%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 16 (4.22%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 9 (2.37%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 28 11 6 12 28 2 8 6 0 2 4 11 0 6 19
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 3 1 3 10 10 0 3 10 12 1 6 7 9 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 11 0 1 10 15 0 0 1 4 12 2 1 2 14 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 5 1 5 6 7 2 3 0 6 0 1 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
83 97 108 92
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 96 76 155
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 156 150 62
ND1 (size: 956 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.79%)
Alanine (Ala, A)
n = 30 (9.46%)
Serine (Ser, S)
n = 18 (5.68%)
Threonine (Thr, T)
n = 23 (7.26%)
Cysteine (Cys, C)
n = 1 (0.32%)
Valine (Val, V)
n = 15 (4.73%)
Leucine (Leu, L)
n = 55 (17.35%)
Isoleucine (Ile, I)
n = 29 (9.15%)
Methionine (Met, M)
n = 20 (6.31%)
Proline (Pro, P)
n = 22 (6.94%)
Phenylalanine (Phe, F)
n = 20 (6.31%)
Tyrosine (Tyr, Y)
n = 13 (4.1%)
Tryptophan (Trp, W)
n = 9 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.95%)
Glutamic acid (Glu, E)
n = 11 (3.47%)
Asparagine (Asn, N)
n = 13 (4.1%)
Glutamine (Gln, Q)
n = 6 (1.89%)
Histidine (His, H)
n = 3 (0.95%)
Lysine (Lys, K)
n = 7 (2.21%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 23 15 3 12 35 2 2 5 1 2 3 9 1 8 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 0 5 15 9 1 0 3 9 0 3 10 7 2 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 11 1 1 5 10 0 0 2 6 7 0 1 6 7 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 9 2 0 3 6 1 1 0 6 1 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 91 94 62
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 91 56 139
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 114 142 44
ND2 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (4.34%)
Alanine (Ala, A)
n = 18 (5.2%)
Serine (Ser, S)
n = 29 (8.38%)
Threonine (Thr, T)
n = 38 (10.98%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 9 (2.6%)
Leucine (Leu, L)
n = 48 (13.87%)
Isoleucine (Ile, I)
n = 40 (11.56%)
Methionine (Met, M)
n = 44 (12.72%)
Proline (Pro, P)
n = 19 (5.49%)
Phenylalanine (Phe, F)
n = 12 (3.47%)
Tyrosine (Tyr, Y)
n = 11 (3.18%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 6 (1.73%)
Asparagine (Asn, N)
n = 14 (4.05%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 3 (0.87%)
Lysine (Lys, K)
n = 15 (4.34%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 27 40 4 8 26 1 8 9 0 1 3 5 0 7 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 0 2 8 8 0 0 7 8 0 4 7 8 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 20 0 4 9 13 1 0 2 5 6 0 1 2 12 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 6 0 1 1 15 0 0 0 4 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
50 74 153 70
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 102 60 153
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 111 180 49
ND3 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (4.34%)
Alanine (Ala, A)
n = 18 (5.2%)
Serine (Ser, S)
n = 29 (8.38%)
Threonine (Thr, T)
n = 38 (10.98%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 9 (2.6%)
Leucine (Leu, L)
n = 48 (13.87%)
Isoleucine (Ile, I)
n = 40 (11.56%)
Methionine (Met, M)
n = 44 (12.72%)
Proline (Pro, P)
n = 19 (5.49%)
Phenylalanine (Phe, F)
n = 12 (3.47%)
Tyrosine (Tyr, Y)
n = 11 (3.18%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 6 (1.73%)
Asparagine (Asn, N)
n = 14 (4.05%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 3 (0.87%)
Lysine (Lys, K)
n = 15 (4.34%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 27 40 4 8 26 1 8 9 0 1 3 5 0 7 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 0 2 8 8 0 0 7 8 0 4 7 8 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 20 0 4 9 13 1 0 2 5 6 0 1 2 12 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 6 0 1 1 15 0 0 0 4 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
50 74 153 70
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 102 60 153
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 111 180 49
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.93%)
Alanine (Ala, A)
n = 33 (7.21%)
Serine (Ser, S)
n = 37 (8.08%)
Threonine (Thr, T)
n = 38 (8.3%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 17 (3.71%)
Leucine (Leu, L)
n = 91 (19.87%)
Isoleucine (Ile, I)
n = 42 (9.17%)
Methionine (Met, M)
n = 35 (7.64%)
Proline (Pro, P)
n = 21 (4.59%)
Phenylalanine (Phe, F)
n = 16 (3.49%)
Tyrosine (Tyr, Y)
n = 18 (3.93%)
Tryptophan (Trp, W)
n = 13 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 8 (1.75%)
Asparagine (Asn, N)
n = 23 (5.02%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 9 (1.97%)
Lysine (Lys, K)
n = 13 (2.84%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
25 17 30 13 13 47 5 11 9 2 1 4 10 2 7 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 3 9 12 11 1 3 5 8 2 8 7 4 2 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 19 2 2 8 17 0 3 7 6 12 1 2 9 14 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 8 0 2 1 12 1 0 2 8 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
79 129 161 90
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
54 119 85 201
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
25 127 206 101
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 7 (7.14%)
Serine (Ser, S)
n = 8 (8.16%)
Threonine (Thr, T)
n = 6 (6.12%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 8 (8.16%)
Leucine (Leu, L)
n = 21 (21.43%)
Isoleucine (Ile, I)
n = 5 (5.1%)
Methionine (Met, M)
n = 11 (11.22%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 5 (5.1%)
Tyrosine (Tyr, Y)
n = 4 (4.08%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 7 (7.14%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 3 8 2 1 10 2 5 2 0 0 2 6 0 1 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 2 2 1 4 0 1 2 0 1 0 1 0 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 2 0 4 2 2 0 0 0 1 3 0 1 2 5 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 0 0 1 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
22 21 29 27
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
8 22 19 50
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 31 43 18
ND5 (size: 1830 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (4.43%)
Alanine (Ala, A)
n = 39 (6.4%)
Serine (Ser, S)
n = 49 (8.05%)
Threonine (Thr, T)
n = 53 (8.7%)
Cysteine (Cys, C)
n = 4 (0.66%)
Valine (Val, V)
n = 19 (3.12%)
Leucine (Leu, L)
n = 92 (15.11%)
Isoleucine (Ile, I)
n = 60 (9.85%)
Methionine (Met, M)
n = 38 (6.24%)
Proline (Pro, P)
n = 25 (4.11%)
Phenylalanine (Phe, F)
n = 43 (7.06%)
Tyrosine (Tyr, Y)
n = 23 (3.78%)
Tryptophan (Trp, W)
n = 13 (2.13%)
Aspartic acid (Asp, D)
n = 10 (1.64%)
Glutamic acid (Glu, E)
n = 13 (2.13%)
Asparagine (Asn, N)
n = 35 (5.75%)
Glutamine (Gln, Q)
n = 19 (3.12%)
Histidine (His, H)
n = 13 (2.13%)
Lysine (Lys, K)
n = 24 (3.94%)
Arginine (Arg, R)
n = 10 (1.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 40 35 15 16 40 5 16 17 2 4 3 10 2 20 23
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 2 8 16 14 1 2 9 14 2 4 7 12 2 14
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
22 16 1 7 12 18 2 1 9 13 10 1 0 12 23 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 9 4 2 8 22 2 2 2 6 0 0 0 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
108 143 220 139
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
64 156 138 252
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
27 212 242 129
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (14.29%)
Alanine (Ala, A)
n = 11 (6.29%)
Serine (Ser, S)
n = 11 (6.29%)
Threonine (Thr, T)
n = 12 (6.86%)
Cysteine (Cys, C)
n = 2 (1.14%)
Valine (Val, V)
n = 22 (12.57%)
Leucine (Leu, L)
n = 18 (10.29%)
Isoleucine (Ile, I)
n = 13 (7.43%)
Methionine (Met, M)
n = 8 (4.57%)
Proline (Pro, P)
n = 4 (2.29%)
Phenylalanine (Phe, F)
n = 14 (8.0%)
Tyrosine (Tyr, Y)
n = 9 (5.14%)
Tryptophan (Trp, W)
n = 4 (2.29%)
Aspartic acid (Asp, D)
n = 4 (2.29%)
Glutamic acid (Glu, E)
n = 9 (5.14%)
Asparagine (Asn, N)
n = 4 (2.29%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 4 (2.29%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 0 2 2 0 0 0 9 0 0 4 2 6 10 14 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 2 0 5 1 2 3 13 1 5 6 4 0 0 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 3 3 4 0 3 0 2 2 8 1 3 7 4 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 3 6 4 0 1 3 1 0 0 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 7 45 53
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 34 31 75
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
47 7 36 86
Total protein-coding genes (size: 11416 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 217 (5.71%)
Alanine (Ala, A)
n = 257 (6.76%)
Serine (Ser, S)
n = 279 (7.34%)
Threonine (Thr, T)
n = 314 (8.26%)
Cysteine (Cys, C)
n = 24 (0.63%)
Valine (Val, V)
n = 184 (4.84%)
Leucine (Leu, L)
n = 589 (15.49%)
Isoleucine (Ile, I)
n = 337 (8.86%)
Methionine (Met, M)
n = 250 (6.58%)
Proline (Pro, P)
n = 191 (5.02%)
Phenylalanine (Phe, F)
n = 228 (6.0%)
Tyrosine (Tyr, Y)
n = 145 (3.81%)
Tryptophan (Trp, W)
n = 105 (2.76%)
Aspartic acid (Asp, D)
n = 66 (1.74%)
Glutamic acid (Glu, E)
n = 99 (2.6%)
Asparagine (Asn, N)
n = 158 (4.16%)
Glutamine (Gln, Q)
n = 90 (2.37%)
Histidine (His, H)
n = 91 (2.39%)
Lysine (Lys, K)
n = 104 (2.74%)
Arginine (Arg, R)
n = 67 (1.76%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
155 182 198 75 86 262 31 114 80 10 33 35 95 21 109 119
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
52 11 13 56 109 84 8 34 61 101 21 50 67 65 9 78
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
98 125 13 41 65 122 4 11 36 69 76 16 21 61 97 31
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
60 80 19 29 37 93 11 8 10 46 3 1 0 7 0 89
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
823 893 1211 876
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
461 994 760 1588
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
239 1151 1562 851

F a i l e d  t o  u n d e r s t a n d  i d :  ? t e r m = ( " P r i o n a i l u r u s  b e n g a l e n s i s " [ O r g a n i s m ] )  A N D  ( r e f s e q [ f i l t e r ]  A N D  m i t o c h o n d r i o n [ f i l t e r ] ) 



Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.