Viewing data for Elaphodus cephalophus


Scientific name Elaphodus cephalophus
Common name Tufted deer
Maximum lifespan 22.70 years (Elaphodus cephalophus@AnAge)

Total mtDNA (size: 16347 bases) GC AT G C A T
Base content (bases) 6120 10227 3904 2216 4809 5418
Base content per 1 kb (bases) 374 626 239 136 294 331
Base content (%) 37.4% 62.6%
Total protein-coding genes (size: 11346 bases) GC AT G C A T
Base content (bases) 4234 7112 2837 1397 3466 3646
Base content per 1 kb (bases) 373 627 250 123 305 321
Base content (%) 37.3% 62.7%
D-loop (size: 913 bases) GC AT G C A T
Base content (bases) 357 556 221 136 283 273
Base content per 1 kb (bases) 391 609 242 149 310 299
Base content (%) 39.1% 60.9%
Total tRNA-coding genes (size: 1516 bases) GC AT G C A T
Base content (bases) 542 974 313 229 430 544
Base content per 1 kb (bases) 358 642 206 151 284 359
Base content (%) 35.8% 64.2%
Total rRNA-coding genes (size: 2523 bases) GC AT G C A T
Base content (bases) 967 1556 522 445 620 936
Base content per 1 kb (bases) 383 617 207 176 246 371
Base content (%) 38.3% 61.7%
12S rRNA gene (size: 957 bases) GC AT G C A T
Base content (bases) 386 571 214 172 221 350
Base content per 1 kb (bases) 403 597 224 180 231 366
Base content (%) 40.3% 59.7%
16S rRNA gene (size: 1566 bases) GC AT G C A T
Base content (bases) 581 985 308 273 399 586
Base content per 1 kb (bases) 371 629 197 174 255 374
Base content (%) 37.1% 62.9%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 252 429 169 83 216 213
Base content per 1 kb (bases) 370 630 248 122 317 313
Base content (%) 37.0% 63.0%
ATP8 (size: 842 bases) GC AT G C A T
Base content (bases) 292 550 201 91 269 281
Base content per 1 kb (bases) 347 653 239 108 319 334
Base content (%) 34.7% 65.3%
COX1 (size: 1545 bases) GC AT G C A T
Base content (bases) 595 950 344 251 502 448
Base content per 1 kb (bases) 385 615 223 162 325 290
Base content (%) 38.5% 61.5%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 255 429 156 99 198 231
Base content per 1 kb (bases) 373 627 228 145 289 338
Base content (%) 37.3% 62.7%
COX3 (size: 785 bases) GC AT G C A T
Base content (bases) 325 460 206 119 253 207
Base content per 1 kb (bases) 414 586 262 152 322 264
Base content (%) 41.4% 58.6%
CYTB (size: 1143 bases) GC AT G C A T
Base content (bases) 454 689 299 155 339 350
Base content per 1 kb (bases) 397 603 262 136 297 306
Base content (%) 39.7% 60.3%
ND1 (size: 957 bases) GC AT G C A T
Base content (bases) 360 597 248 112 295 302
Base content per 1 kb (bases) 376 624 259 117 308 316
Base content (%) 37.6% 62.4%
ND2 (size: 1044 bases) GC AT G C A T
Base content (bases) 365 679 270 95 303 376
Base content per 1 kb (bases) 350 650 259 91 290 360
Base content (%) 35.0% 65.0%
ND3 (size: 347 bases) GC AT G C A T
Base content (bases) 131 216 90 41 106 110
Base content per 1 kb (bases) 378 622 259 118 305 317
Base content (%) 37.8% 62.2%
ND4 (size: 1379 bases) GC AT G C A T
Base content (bases) 517 862 360 157 427 435
Base content per 1 kb (bases) 375 625 261 114 310 315
Base content (%) 37.5% 62.5%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 107 190 68 39 98 92
Base content per 1 kb (bases) 360 640 229 131 330 310
Base content (%) 36.0% 64.0%
ND5 (size: 1821 bases) GC AT G C A T
Base content (bases) 651 1170 452 199 562 608
Base content per 1 kb (bases) 357 643 248 109 309 334
Base content (%) 35.7% 64.3%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 189 339 147 42 122 217
Base content per 1 kb (bases) 358 642 278 80 231 411
Base content (%) 35.8% 64.2%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (5.31%)
Alanine (Ala, A)
n = 16 (7.08%)
Serine (Ser, S)
n = 13 (5.75%)
Threonine (Thr, T)
n = 23 (10.18%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 13 (5.75%)
Leucine (Leu, L)
n = 43 (19.03%)
Isoleucine (Ile, I)
n = 23 (10.18%)
Methionine (Met, M)
n = 14 (6.19%)
Proline (Pro, P)
n = 12 (5.31%)
Phenylalanine (Phe, F)
n = 13 (5.75%)
Tyrosine (Tyr, Y)
n = 2 (0.88%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 12 (5.31%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 6 (2.65%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 4 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 8 13 13 4 10 3 8 8 1 3 2 7 1 12 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 2 9 4 1 1 3 7 1 1 3 8 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 14 0 2 1 6 0 2 2 1 1 0 5 8 4 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 3 0 0 1 2 2 1 2 1 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
45 61 80 41
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
23 60 38 106
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 48 95 69
ATP8 (size: 201 bases)
Amino acid sequence: MPQLDTSTWFVMIMSMFLVLFIIFQLKISKHNFHFNPEPMLTKTQKQNIPWETKWTKIYLPLLLSQ*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 4 (6.06%)
Threonine (Thr, T)
n = 6 (9.09%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 2 (3.03%)
Leucine (Leu, L)
n = 9 (13.64%)
Isoleucine (Ile, I)
n = 6 (9.09%)
Methionine (Met, M)
n = 5 (7.58%)
Proline (Pro, P)
n = 5 (7.58%)
Phenylalanine (Phe, F)
n = 6 (9.09%)
Tyrosine (Tyr, Y)
n = 1 (1.52%)
Tryptophan (Trp, W)
n = 3 (4.55%)
Aspartic acid (Asp, D)
n = 1 (1.52%)
Glutamic acid (Glu, E)
n = 2 (3.03%)
Asparagine (Asn, N)
n = 3 (4.55%)
Glutamine (Gln, Q)
n = 5 (7.58%)
Histidine (His, H)
n = 2 (3.03%)
Lysine (Lys, K)
n = 6 (9.09%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 1 4 1 1 3 0 3 5 0 1 1 0 0 6 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 0 0 0 0 0 0 3 0 2 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 4 1 0 2 2 0 0 0 1 0 0 1 3 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 0 1 6 0 0 0 0 0 0 0 0 1 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
5 17 26 19
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
3 15 21 28
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 7 34 22
COX1 (size: 1545 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.14%)
Alanine (Ala, A)
n = 39 (7.59%)
Serine (Ser, S)
n = 32 (6.23%)
Threonine (Thr, T)
n = 38 (7.39%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 37 (7.2%)
Leucine (Leu, L)
n = 58 (11.28%)
Isoleucine (Ile, I)
n = 39 (7.59%)
Methionine (Met, M)
n = 33 (6.42%)
Proline (Pro, P)
n = 28 (5.45%)
Phenylalanine (Phe, F)
n = 41 (7.98%)
Tyrosine (Tyr, Y)
n = 20 (3.89%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 14 (2.72%)
Glutamic acid (Glu, E)
n = 10 (1.95%)
Asparagine (Asn, N)
n = 20 (3.89%)
Glutamine (Gln, Q)
n = 6 (1.17%)
Histidine (His, H)
n = 17 (3.31%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
33 6 25 8 7 27 1 14 6 0 11 5 18 3 25 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 0 1 11 12 15 1 11 7 20 9 12 6 10 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 20 1 8 5 15 1 1 2 14 6 0 1 13 7 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 8 2 7 7 9 0 1 2 4 1 0 0 1 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
147 102 142 124
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 134 97 208
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 108 209 170
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 8 (3.52%)
Serine (Ser, S)
n = 21 (9.25%)
Threonine (Thr, T)
n = 18 (7.93%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 13 (5.73%)
Leucine (Leu, L)
n = 34 (14.98%)
Isoleucine (Ile, I)
n = 18 (7.93%)
Methionine (Met, M)
n = 15 (6.61%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 6 (2.64%)
Tyrosine (Tyr, Y)
n = 10 (4.41%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 10 (4.41%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 5 (2.2%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 8 (3.52%)
Lysine (Lys, K)
n = 6 (2.64%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 6 10 3 3 16 2 9 5 1 4 2 5 2 4 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 2 3 2 3 0 1 2 3 2 3 2 7 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 10 2 7 3 6 0 0 5 6 4 1 1 5 0 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 13 2 4 6 6 0 0 1 5 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
54 57 67 50
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 55 61 86
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 44 103 62
COX3 (size: 785 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 15 (5.77%)
Serine (Ser, S)
n = 21 (8.08%)
Threonine (Thr, T)
n = 24 (9.23%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 13 (5.0%)
Leucine (Leu, L)
n = 32 (12.31%)
Isoleucine (Ile, I)
n = 19 (7.31%)
Methionine (Met, M)
n = 8 (3.08%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 6 (2.31%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 4 7 4 4 10 1 13 5 2 3 5 5 0 12 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 1 5 8 2 0 3 9 6 2 1 6 5 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 8 2 4 2 9 0 3 3 11 0 5 0 4 2 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 7 1 1 2 1 1 0 3 2 0 0 0 0 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
59 60 65 77
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
45 66 54 96
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 80 87 79
CYTB (size: 1143 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.32%)
Alanine (Ala, A)
n = 23 (6.05%)
Serine (Ser, S)
n = 23 (6.05%)
Threonine (Thr, T)
n = 26 (6.84%)
Cysteine (Cys, C)
n = 4 (1.05%)
Valine (Val, V)
n = 19 (5.0%)
Leucine (Leu, L)
n = 58 (15.26%)
Isoleucine (Ile, I)
n = 40 (10.53%)
Methionine (Met, M)
n = 15 (3.95%)
Proline (Pro, P)
n = 23 (6.05%)
Phenylalanine (Phe, F)
n = 28 (7.37%)
Tyrosine (Tyr, Y)
n = 15 (3.95%)
Tryptophan (Trp, W)
n = 12 (3.16%)
Aspartic acid (Asp, D)
n = 11 (2.89%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 18 (4.74%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 11 (2.89%)
Lysine (Lys, K)
n = 10 (2.63%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
27 13 11 6 14 26 5 6 4 2 4 6 9 0 12 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 4 0 6 16 1 4 3 14 3 3 5 15 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 15 2 4 5 11 0 2 1 11 4 1 1 8 10 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 6 0 4 7 10 0 0 1 6 1 0 0 0 1 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
83 99 112 87
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
51 92 78 160
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 108 160 92
ND1 (size: 957 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.77%)
Alanine (Ala, A)
n = 27 (8.49%)
Serine (Ser, S)
n = 23 (7.23%)
Threonine (Thr, T)
n = 19 (5.97%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 14 (4.4%)
Leucine (Leu, L)
n = 55 (17.3%)
Isoleucine (Ile, I)
n = 32 (10.06%)
Methionine (Met, M)
n = 18 (5.66%)
Proline (Pro, P)
n = 22 (6.92%)
Phenylalanine (Phe, F)
n = 23 (7.23%)
Tyrosine (Tyr, Y)
n = 11 (3.46%)
Tryptophan (Trp, W)
n = 9 (2.83%)
Aspartic acid (Asp, D)
n = 3 (0.94%)
Glutamic acid (Glu, E)
n = 11 (3.46%)
Asparagine (Asn, N)
n = 13 (4.09%)
Glutamine (Gln, Q)
n = 7 (2.2%)
Histidine (His, H)
n = 3 (0.94%)
Lysine (Lys, K)
n = 7 (2.2%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
24 8 16 5 8 29 1 12 6 1 0 5 8 1 13 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 5 5 16 1 0 5 7 0 8 6 7 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 14 0 5 6 9 0 0 3 7 4 0 0 6 7 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 10 1 0 3 6 1 1 0 4 3 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 83 92 77
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 88 56 142
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 77 154 76
ND2 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.03%)
Alanine (Ala, A)
n = 18 (5.19%)
Serine (Ser, S)
n = 28 (8.07%)
Threonine (Thr, T)
n = 37 (10.66%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 13 (3.75%)
Leucine (Leu, L)
n = 54 (15.56%)
Isoleucine (Ile, I)
n = 35 (10.09%)
Methionine (Met, M)
n = 42 (12.1%)
Proline (Pro, P)
n = 21 (6.05%)
Phenylalanine (Phe, F)
n = 14 (4.03%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.88%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.44%)
Asparagine (Asn, N)
n = 16 (4.61%)
Glutamine (Gln, Q)
n = 9 (2.59%)
Histidine (His, H)
n = 5 (1.44%)
Lysine (Lys, K)
n = 13 (3.75%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 16 37 5 11 25 0 12 9 0 4 3 5 1 7 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 0 4 6 8 0 2 5 7 0 2 8 9 2 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 16 1 4 6 16 0 1 1 6 2 1 1 6 10 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 4 1 0 1 12 1 0 0 4 0 0 0 0 1 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
51 80 145 72
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 102 58 158
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 88 173 73
ND3 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.03%)
Alanine (Ala, A)
n = 18 (5.19%)
Serine (Ser, S)
n = 28 (8.07%)
Threonine (Thr, T)
n = 37 (10.66%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 13 (3.75%)
Leucine (Leu, L)
n = 54 (15.56%)
Isoleucine (Ile, I)
n = 35 (10.09%)
Methionine (Met, M)
n = 42 (12.1%)
Proline (Pro, P)
n = 21 (6.05%)
Phenylalanine (Phe, F)
n = 14 (4.03%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.88%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.44%)
Asparagine (Asn, N)
n = 16 (4.61%)
Glutamine (Gln, Q)
n = 9 (2.59%)
Histidine (His, H)
n = 5 (1.44%)
Lysine (Lys, K)
n = 13 (3.75%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 16 37 5 11 25 0 12 9 0 4 3 5 1 7 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 0 4 6 8 0 2 5 7 0 2 8 9 2 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 16 1 4 6 16 0 1 1 6 2 1 1 6 10 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 4 1 0 1 12 1 0 0 4 0 0 0 0 1 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
51 80 145 72
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 102 58 158
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 88 173 73
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.93%)
Alanine (Ala, A)
n = 26 (5.68%)
Serine (Ser, S)
n = 40 (8.73%)
Threonine (Thr, T)
n = 39 (8.52%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 17 (3.71%)
Leucine (Leu, L)
n = 94 (20.52%)
Isoleucine (Ile, I)
n = 39 (8.52%)
Methionine (Met, M)
n = 34 (7.42%)
Proline (Pro, P)
n = 20 (4.37%)
Phenylalanine (Phe, F)
n = 22 (4.8%)
Tyrosine (Tyr, Y)
n = 18 (3.93%)
Tryptophan (Trp, W)
n = 13 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 10 (2.18%)
Asparagine (Asn, N)
n = 21 (4.59%)
Glutamine (Gln, Q)
n = 10 (2.18%)
Histidine (His, H)
n = 10 (2.18%)
Lysine (Lys, K)
n = 12 (2.62%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
27 12 26 13 13 34 5 23 9 1 3 5 9 0 10 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 2 1 3 12 10 1 3 7 7 1 4 9 7 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 19 2 7 11 11 0 3 8 11 7 0 6 6 15 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 7 3 1 2 11 1 0 2 8 0 0 0 0 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 115 156 114
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
55 114 84 206
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 131 194 106
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 8 (8.16%)
Serine (Ser, S)
n = 9 (9.18%)
Threonine (Thr, T)
n = 8 (8.16%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 8 (8.16%)
Leucine (Leu, L)
n = 22 (22.45%)
Isoleucine (Ile, I)
n = 4 (4.08%)
Methionine (Met, M)
n = 10 (10.2%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 4 (4.08%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 5 (5.1%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 0 7 2 3 9 0 8 2 0 2 0 5 1 1 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 3 1 3 4 0 2 0 2 0 0 1 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 5 0 1 3 3 1 0 1 3 1 0 0 4 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 0 2 1 0 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
23 20 28 28
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 25 17 48
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 23 47 22
ND5 (size: 1821 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (4.62%)
Alanine (Ala, A)
n = 42 (6.93%)
Serine (Ser, S)
n = 47 (7.76%)
Threonine (Thr, T)
n = 54 (8.91%)
Cysteine (Cys, C)
n = 5 (0.83%)
Valine (Val, V)
n = 18 (2.97%)
Leucine (Leu, L)
n = 84 (13.86%)
Isoleucine (Ile, I)
n = 61 (10.07%)
Methionine (Met, M)
n = 43 (7.1%)
Proline (Pro, P)
n = 26 (4.29%)
Phenylalanine (Phe, F)
n = 49 (8.09%)
Tyrosine (Tyr, Y)
n = 17 (2.81%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 10 (1.65%)
Glutamic acid (Glu, E)
n = 11 (1.82%)
Asparagine (Asn, N)
n = 37 (6.11%)
Glutamine (Gln, Q)
n = 19 (3.14%)
Histidine (His, H)
n = 12 (1.98%)
Lysine (Lys, K)
n = 23 (3.8%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
41 20 37 11 13 38 3 17 17 2 5 5 5 3 25 24
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 2 3 5 15 22 0 7 8 12 1 2 14 9 1 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 27 2 10 7 16 1 7 6 12 5 0 2 23 14 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 9 2 6 4 22 1 0 5 3 0 0 0 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
109 130 231 137
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
66 156 130 255
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 166 247 170
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (14.86%)
Alanine (Ala, A)
n = 8 (4.57%)
Serine (Ser, S)
n = 11 (6.29%)
Threonine (Thr, T)
n = 9 (5.14%)
Cysteine (Cys, C)
n = 1 (0.57%)
Valine (Val, V)
n = 20 (11.43%)
Leucine (Leu, L)
n = 19 (10.86%)
Isoleucine (Ile, I)
n = 17 (9.71%)
Methionine (Met, M)
n = 11 (6.29%)
Proline (Pro, P)
n = 3 (1.71%)
Phenylalanine (Phe, F)
n = 13 (7.43%)
Tyrosine (Tyr, Y)
n = 10 (5.71%)
Tryptophan (Trp, W)
n = 4 (2.29%)
Aspartic acid (Asp, D)
n = 4 (2.29%)
Glutamic acid (Glu, E)
n = 9 (5.14%)
Asparagine (Asn, N)
n = 4 (2.29%)
Glutamine (Gln, Q)
n = 2 (1.14%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 3 (1.71%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 0 6 2 0 1 2 10 1 1 6 1 6 7 13 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 0 4 1 2 1 11 0 5 10 3 0 0 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 4 1 5 0 0 2 4 0 8 2 2 4 4 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 7 4 0 1 2 1 0 0 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 11 48 50
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 27 33 80
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
44 4 41 87
Total protein-coding genes (size: 11411 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 217 (5.71%)
Alanine (Ala, A)
n = 241 (6.34%)
Serine (Ser, S)
n = 279 (7.34%)
Threonine (Thr, T)
n = 310 (8.16%)
Cysteine (Cys, C)
n = 23 (0.61%)
Valine (Val, V)
n = 190 (5.0%)
Leucine (Leu, L)
n = 589 (15.5%)
Isoleucine (Ile, I)
n = 338 (8.89%)
Methionine (Met, M)
n = 254 (6.68%)
Proline (Pro, P)
n = 192 (5.05%)
Phenylalanine (Phe, F)
n = 252 (6.63%)
Tyrosine (Tyr, Y)
n = 130 (3.42%)
Tryptophan (Trp, W)
n = 104 (2.74%)
Aspartic acid (Asp, D)
n = 65 (1.71%)
Glutamic acid (Glu, E)
n = 98 (2.58%)
Asparagine (Asn, N)
n = 164 (4.31%)
Glutamine (Gln, Q)
n = 91 (2.39%)
Histidine (His, H)
n = 93 (2.45%)
Lysine (Lys, K)
n = 98 (2.58%)
Arginine (Arg, R)
n = 64 (1.68%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
242 96 205 78 85 239 23 142 80 11 47 40 84 19 146 106
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
49 7 16 46 84 105 6 46 49 93 29 42 63 82 5 63
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
72 161 14 57 52 107 6 23 34 92 38 10 22 93 71 39
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
54 76 22 29 36 89 9 4 17 38 5 0 0 7 3 94
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
811 865 1221 905
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
465 965 749 1623
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
233 913 1602 1054

Failed to understand id: ?term=("Elaphodus cephalophus"[Organism]) AND (refseq[filter] AND mitochondrion[filter])


Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.