Viewing data for Syrmaticus reevesii


Scientific name Syrmaticus reevesii
Common name Reeves pheasant
Maximum lifespan 9.20 years (Syrmaticus reevesii@AnAge)

Total mtDNA (size: 16678 bases) GC AT G C A T
Base content (bases) 7564 9114 5256 2308 4109 5005
Base content per 1 kb (bases) 454 546 315 138 246 300
Base content (%) 45.4% 54.6%
Total protein-coding genes (size: 11373 bases) GC AT G C A T
Base content (bases) 5204 6169 3815 1389 2812 3357
Base content per 1 kb (bases) 458 542 335 122 247 295
Base content (%) 45.8% 54.2%
D-loop (size: 1150 bases) GC AT G C A T
Base content (bases) 492 658 326 166 363 295
Base content per 1 kb (bases) 428 572 283 144 316 257
Base content (%) 42.8% 57.2%
Total tRNA-coding genes (size: 1551 bases) GC AT G C A T
Base content (bases) 665 886 392 273 388 498
Base content per 1 kb (bases) 429 571 253 176 250 321
Base content (%) 42.9% 57.1%
Total rRNA-coding genes (size: 2574 bases) GC AT G C A T
Base content (bases) 1186 1388 705 481 541 847
Base content per 1 kb (bases) 461 539 274 187 210 329
Base content (%) 46.1% 53.9%
12S rRNA gene (size: 967 bases) GC AT G C A T
Base content (bases) 462 505 272 190 193 312
Base content per 1 kb (bases) 478 522 281 196 200 323
Base content (%) 47.8% 52.2%
16S rRNA gene (size: 1607 bases) GC AT G C A T
Base content (bases) 724 883 433 291 348 535
Base content per 1 kb (bases) 451 549 269 181 217 333
Base content (%) 45.1% 54.9%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 323 361 251 72 173 188
Base content per 1 kb (bases) 472 528 367 105 253 275
Base content (%) 47.2% 52.8%
ATP8 (size: 165 bases) GC AT G C A T
Base content (bases) 66 99 59 7 39 60
Base content per 1 kb (bases) 400 600 358 42 236 364
Base content (%) 40.0% 60.0%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 715 836 464 251 416 420
Base content per 1 kb (bases) 461 539 299 162 268 271
Base content (%) 46.1% 53.9%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 305 379 209 96 176 203
Base content per 1 kb (bases) 446 554 306 140 257 297
Base content (%) 44.6% 55.4%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 370 414 249 121 200 214
Base content per 1 kb (bases) 472 528 318 154 255 273
Base content (%) 47.2% 52.8%
CYTB (size: 1143 bases) GC AT G C A T
Base content (bases) 540 603 399 141 284 319
Base content per 1 kb (bases) 472 528 349 123 248 279
Base content (%) 47.2% 52.8%
ND1 (size: 975 bases) GC AT G C A T
Base content (bases) 457 518 330 127 259 259
Base content per 1 kb (bases) 469 531 338 130 266 266
Base content (%) 46.9% 53.1%
ND2 (size: 1039 bases) GC AT G C A T
Base content (bases) 455 584 358 97 260 324
Base content per 1 kb (bases) 438 562 345 93 250 312
Base content (%) 43.8% 56.2%
ND3 (size: 352 bases) GC AT G C A T
Base content (bases) 164 188 119 45 90 98
Base content per 1 kb (bases) 466 534 338 128 256 278
Base content (%) 46.6% 53.4%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 616 762 470 146 338 424
Base content per 1 kb (bases) 447 553 341 106 245 308
Base content (%) 44.7% 55.3%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 142 155 101 41 80 75
Base content per 1 kb (bases) 478 522 340 138 269 253
Base content (%) 47.8% 52.2%
ND5 (size: 1818 bases) GC AT G C A T
Base content (bases) 816 1002 619 197 442 560
Base content per 1 kb (bases) 449 551 340 108 243 308
Base content (%) 44.9% 55.1%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 240 282 190 50 59 223
Base content per 1 kb (bases) 460 540 364 96 113 427
Base content (%) 46.0% 54.0%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.96%)
Alanine (Ala, A)
n = 16 (7.05%)
Serine (Ser, S)
n = 17 (7.49%)
Threonine (Thr, T)
n = 22 (9.69%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 7 (3.08%)
Leucine (Leu, L)
n = 62 (27.31%)
Isoleucine (Ile, I)
n = 19 (8.37%)
Methionine (Met, M)
n = 9 (3.96%)
Proline (Pro, P)
n = 17 (7.49%)
Phenylalanine (Phe, F)
n = 6 (2.64%)
Tyrosine (Tyr, Y)
n = 4 (1.76%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 9 (3.96%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 5 (2.2%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 13 8 12 16 23 4 7 8 0 0 3 4 0 4 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 12 3 1 0 4 4 1 1 7 6 3 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 8 0 5 4 4 0 0 4 1 3 2 0 1 8 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 4 0 0 1 3 0 1 1 2 1 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
37 90 66 35
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
22 68 35 103
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 93 87 35
ATP8 (size: 165 bases)
Amino acid sequence: MPQLNPNPWFTIMILTWFTFSLLIQPKLLSFISMNNPMNKTSTTKPTPWTWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 4 (7.41%)
Threonine (Thr, T)
n = 9 (16.67%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 6 (11.11%)
Isoleucine (Ile, I)
n = 4 (7.41%)
Methionine (Met, M)
n = 4 (7.41%)
Proline (Pro, P)
n = 8 (14.81%)
Phenylalanine (Phe, F)
n = 4 (7.41%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.26%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 5 (9.26%)
Glutamine (Gln, Q)
n = 2 (3.7%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 3 (5.56%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 2 2 0 3 3 0 0 2 0 0 0 0 0 1 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 0 0 0 0 0 0 0 0 2 3 3 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 2 0 0 1 3 0 0 0 0 0 0 0 2 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 0 0 3 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
0 16 25 14
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 21 11 18
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 22 24 7
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.11%)
Alanine (Ala, A)
n = 45 (8.72%)
Serine (Ser, S)
n = 28 (5.43%)
Threonine (Thr, T)
n = 39 (7.56%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 35 (6.78%)
Leucine (Leu, L)
n = 63 (12.21%)
Isoleucine (Ile, I)
n = 41 (7.95%)
Methionine (Met, M)
n = 24 (4.65%)
Proline (Pro, P)
n = 31 (6.01%)
Phenylalanine (Phe, F)
n = 43 (8.33%)
Tyrosine (Tyr, Y)
n = 17 (3.29%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 15 (2.91%)
Glutamine (Gln, Q)
n = 9 (1.74%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 24 20 13 13 26 4 6 7 2 6 12 14 3 9 34
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 10 18 17 0 6 16 23 2 7 12 10 2 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 17 0 1 8 15 1 0 3 9 8 1 1 4 11 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 9 1 3 12 9 0 1 2 5 0 0 1 0 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
152 123 132 110
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 140 94 206
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 201 194 100
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 13 (5.73%)
Serine (Ser, S)
n = 18 (7.93%)
Threonine (Thr, T)
n = 19 (8.37%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 15 (6.61%)
Leucine (Leu, L)
n = 30 (13.22%)
Isoleucine (Ile, I)
n = 17 (7.49%)
Methionine (Met, M)
n = 10 (4.41%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 10 (4.41%)
Tyrosine (Tyr, Y)
n = 7 (3.08%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 14 (6.17%)
Glutamic acid (Glu, E)
n = 13 (5.73%)
Asparagine (Asn, N)
n = 5 (2.2%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 9 (3.96%)
Lysine (Lys, K)
n = 5 (2.2%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 11 8 10 5 7 4 4 8 0 2 4 7 2 3 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 4 5 4 0 0 2 6 0 5 5 3 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 4 0 1 8 7 0 1 1 2 5 0 0 1 4 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 11 2 3 11 5 0 0 2 3 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
63 61 58 46
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
23 61 62 82
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 87 83 48
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.31%)
Alanine (Ala, A)
n = 23 (8.85%)
Serine (Ser, S)
n = 21 (8.08%)
Threonine (Thr, T)
n = 19 (7.31%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 14 (5.38%)
Leucine (Leu, L)
n = 33 (12.69%)
Isoleucine (Ile, I)
n = 15 (5.77%)
Methionine (Met, M)
n = 10 (3.85%)
Proline (Pro, P)
n = 11 (4.23%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 9 (3.46%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 6 (2.31%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 11 8 7 6 15 2 2 6 1 4 6 3 1 5 19
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 2 10 11 0 1 8 8 2 1 4 6 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 8 0 2 5 9 0 1 4 4 5 1 1 2 4 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 7 1 0 4 3 0 0 0 5 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 70 58 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 69 54 96
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 110 102 38
CYTB (size: 1143 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.32%)
Alanine (Ala, A)
n = 28 (7.37%)
Serine (Ser, S)
n = 27 (7.11%)
Threonine (Thr, T)
n = 27 (7.11%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 16 (4.21%)
Leucine (Leu, L)
n = 65 (17.11%)
Isoleucine (Ile, I)
n = 32 (8.42%)
Methionine (Met, M)
n = 9 (2.37%)
Proline (Pro, P)
n = 25 (6.58%)
Phenylalanine (Phe, F)
n = 27 (7.11%)
Tyrosine (Tyr, Y)
n = 14 (3.68%)
Tryptophan (Trp, W)
n = 11 (2.89%)
Aspartic acid (Asp, D)
n = 6 (1.58%)
Glutamic acid (Glu, E)
n = 7 (1.84%)
Asparagine (Asn, N)
n = 21 (5.53%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 12 (3.16%)
Lysine (Lys, K)
n = 10 (2.63%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 26 7 11 18 28 4 4 8 0 2 6 7 1 7 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 2 13 13 0 0 13 9 2 3 8 14 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 6 1 4 9 13 0 0 1 1 13 1 0 3 18 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 6 1 1 5 9 1 0 3 5 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
81 114 100 86
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
47 106 79 149
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 179 140 49
ND1 (size: 975 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.7%)
Alanine (Ala, A)
n = 29 (8.95%)
Serine (Ser, S)
n = 29 (8.95%)
Threonine (Thr, T)
n = 25 (7.72%)
Cysteine (Cys, C)
n = 2 (0.62%)
Valine (Val, V)
n = 14 (4.32%)
Leucine (Leu, L)
n = 65 (20.06%)
Isoleucine (Ile, I)
n = 23 (7.1%)
Methionine (Met, M)
n = 11 (3.4%)
Proline (Pro, P)
n = 26 (8.02%)
Phenylalanine (Phe, F)
n = 19 (5.86%)
Tyrosine (Tyr, Y)
n = 13 (4.01%)
Tryptophan (Trp, W)
n = 8 (2.47%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.4%)
Asparagine (Asn, N)
n = 11 (3.4%)
Glutamine (Gln, Q)
n = 5 (1.54%)
Histidine (His, H)
n = 2 (0.62%)
Lysine (Lys, K)
n = 7 (2.16%)
Arginine (Arg, R)
n = 8 (2.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 15 8 6 15 35 3 6 3 2 4 1 7 2 4 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 0 5 20 4 0 3 3 5 1 4 9 11 2 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 10 1 5 10 8 0 1 5 6 7 2 0 0 11 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 9 2 1 3 5 2 1 2 4 1 0 0 1 0 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 100 83 72
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 103 54 132
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 127 122 55
ND2 (size: 1039 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.48%)
Alanine (Ala, A)
n = 21 (6.09%)
Serine (Ser, S)
n = 36 (10.43%)
Threonine (Thr, T)
n = 47 (13.62%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 6 (1.74%)
Leucine (Leu, L)
n = 63 (18.26%)
Isoleucine (Ile, I)
n = 35 (10.14%)
Methionine (Met, M)
n = 19 (5.51%)
Proline (Pro, P)
n = 21 (6.09%)
Phenylalanine (Phe, F)
n = 14 (4.06%)
Tyrosine (Tyr, Y)
n = 5 (1.45%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 14 (4.06%)
Glutamine (Gln, Q)
n = 10 (2.9%)
Histidine (His, H)
n = 9 (2.61%)
Lysine (Lys, K)
n = 13 (3.77%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 22 13 8 21 22 4 8 8 2 0 2 2 2 5 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 0 3 7 11 0 2 8 2 0 1 12 8 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 20 1 5 11 14 1 2 3 0 5 3 0 2 12 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 5 0 0 1 12 1 1 1 2 0 0 0 0 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
45 99 133 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 120 57 137
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 139 134 53
ND3 (size: 1039 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.48%)
Alanine (Ala, A)
n = 21 (6.09%)
Serine (Ser, S)
n = 36 (10.43%)
Threonine (Thr, T)
n = 47 (13.62%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 6 (1.74%)
Leucine (Leu, L)
n = 63 (18.26%)
Isoleucine (Ile, I)
n = 35 (10.14%)
Methionine (Met, M)
n = 19 (5.51%)
Proline (Pro, P)
n = 21 (6.09%)
Phenylalanine (Phe, F)
n = 14 (4.06%)
Tyrosine (Tyr, Y)
n = 5 (1.45%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 14 (4.06%)
Glutamine (Gln, Q)
n = 10 (2.9%)
Histidine (His, H)
n = 9 (2.61%)
Lysine (Lys, K)
n = 13 (3.77%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 22 13 8 21 22 4 8 8 2 0 2 2 2 5 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 0 3 7 11 0 2 8 2 0 1 12 8 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 20 1 5 11 14 1 2 3 0 5 3 0 2 12 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 5 0 0 1 12 1 1 1 2 0 0 0 0 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
45 99 133 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 120 57 137
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 139 134 53
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (3.49%)
Alanine (Ala, A)
n = 36 (7.86%)
Serine (Ser, S)
n = 39 (8.52%)
Threonine (Thr, T)
n = 48 (10.48%)
Cysteine (Cys, C)
n = 4 (0.87%)
Valine (Val, V)
n = 5 (1.09%)
Leucine (Leu, L)
n = 99 (21.62%)
Isoleucine (Ile, I)
n = 42 (9.17%)
Methionine (Met, M)
n = 24 (5.24%)
Proline (Pro, P)
n = 32 (6.99%)
Phenylalanine (Phe, F)
n = 12 (2.62%)
Tyrosine (Tyr, Y)
n = 14 (3.06%)
Tryptophan (Trp, W)
n = 12 (2.62%)
Aspartic acid (Asp, D)
n = 2 (0.44%)
Glutamic acid (Glu, E)
n = 10 (2.18%)
Asparagine (Asn, N)
n = 14 (3.06%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 18 (3.93%)
Lysine (Lys, K)
n = 11 (2.4%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 27 20 9 27 45 6 11 9 2 0 2 3 0 9 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 4 7 11 16 2 2 5 7 2 6 12 13 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 23 0 4 11 13 0 1 10 5 9 2 1 3 11 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 8 2 0 2 10 1 1 2 6 1 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 158 150 82
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 144 80 182
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 168 194 73
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 10 (10.2%)
Serine (Ser, S)
n = 12 (12.24%)
Threonine (Thr, T)
n = 5 (5.1%)
Cysteine (Cys, C)
n = 4 (4.08%)
Valine (Val, V)
n = 3 (3.06%)
Leucine (Leu, L)
n = 18 (18.37%)
Isoleucine (Ile, I)
n = 3 (3.06%)
Methionine (Met, M)
n = 7 (7.14%)
Proline (Pro, P)
n = 4 (4.08%)
Phenylalanine (Phe, F)
n = 8 (8.16%)
Tyrosine (Tyr, Y)
n = 1 (1.02%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 4 (4.08%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 6 (6.12%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 2 4 1 5 9 0 2 2 0 0 1 2 0 2 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 4 3 4 3 0 2 1 1 0 1 2 1 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 2 0 3 2 4 0 0 3 0 1 1 1 0 4 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 2 1 0 1 0 0 0 0 2 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
21 29 22 27
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
14 28 18 39
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 44 35 14
ND5 (size: 1818 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 31 (5.12%)
Alanine (Ala, A)
n = 44 (7.27%)
Serine (Ser, S)
n = 44 (7.27%)
Threonine (Thr, T)
n = 71 (11.74%)
Cysteine (Cys, C)
n = 6 (0.99%)
Valine (Val, V)
n = 13 (2.15%)
Leucine (Leu, L)
n = 106 (17.52%)
Isoleucine (Ile, I)
n = 60 (9.92%)
Methionine (Met, M)
n = 31 (5.12%)
Proline (Pro, P)
n = 34 (5.62%)
Phenylalanine (Phe, F)
n = 32 (5.29%)
Tyrosine (Tyr, Y)
n = 11 (1.82%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 7 (1.16%)
Glutamic acid (Glu, E)
n = 15 (2.48%)
Asparagine (Asn, N)
n = 24 (3.97%)
Glutamine (Gln, Q)
n = 19 (3.14%)
Histidine (His, H)
n = 14 (2.31%)
Lysine (Lys, K)
n = 23 (3.8%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 43 26 16 36 42 2 9 18 1 2 4 6 1 9 23
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 5 10 24 10 0 3 12 13 3 7 17 10 0 12
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
32 27 0 3 14 16 1 2 8 4 7 1 1 5 19 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 13 2 1 6 20 3 0 3 5 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
110 171 219 106
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
67 183 114 242
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 265 227 94
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (14.45%)
Alanine (Ala, A)
n = 13 (7.51%)
Serine (Ser, S)
n = 12 (6.94%)
Threonine (Thr, T)
n = 2 (1.16%)
Cysteine (Cys, C)
n = 3 (1.73%)
Valine (Val, V)
n = 34 (19.65%)
Leucine (Leu, L)
n = 28 (16.18%)
Isoleucine (Ile, I)
n = 5 (2.89%)
Methionine (Met, M)
n = 5 (2.89%)
Proline (Pro, P)
n = 4 (2.31%)
Phenylalanine (Phe, F)
n = 14 (8.09%)
Tyrosine (Tyr, Y)
n = 8 (4.62%)
Tryptophan (Trp, W)
n = 6 (3.47%)
Aspartic acid (Asp, D)
n = 5 (2.89%)
Glutamic acid (Glu, E)
n = 2 (1.16%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 1 (0.58%)
Arginine (Arg, R)
n = 5 (2.89%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 0 0 2 0 2 2 7 0 0 16 0 6 12 13 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 3 0 2 0 4 7 5 1 2 17 3 0 0 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 0 9 0 1 0 1 1 6 2 4 15 1 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 2 4 1 0 1 1 0 1 3 0 0 0 1 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
79 15 16 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
41 29 18 86
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
70 6 25 73
Total protein-coding genes (size: 11391 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 212 (5.59%)
Alanine (Ala, A)
n = 287 (7.56%)
Serine (Ser, S)
n = 295 (7.77%)
Threonine (Thr, T)
n = 344 (9.06%)
Cysteine (Cys, C)
n = 29 (0.76%)
Valine (Val, V)
n = 163 (4.3%)
Leucine (Leu, L)
n = 664 (17.5%)
Isoleucine (Ile, I)
n = 305 (8.04%)
Methionine (Met, M)
n = 167 (4.4%)
Proline (Pro, P)
n = 233 (6.14%)
Phenylalanine (Phe, F)
n = 222 (5.85%)
Tyrosine (Tyr, Y)
n = 105 (2.77%)
Tryptophan (Trp, W)
n = 108 (2.85%)
Aspartic acid (Asp, D)
n = 63 (1.66%)
Glutamic acid (Glu, E)
n = 94 (2.48%)
Asparagine (Asn, N)
n = 132 (3.48%)
Glutamine (Gln, Q)
n = 93 (2.45%)
Histidine (His, H)
n = 111 (2.92%)
Lysine (Lys, K)
n = 89 (2.35%)
Arginine (Arg, R)
n = 70 (1.84%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
101 204 127 97 175 267 36 68 81 12 36 41 62 24 74 148
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
40 9 20 50 129 98 10 25 74 81 32 41 94 89 9 61
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
149 131 3 42 85 112 3 9 44 40 65 18 21 25 107 22
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
89 80 14 14 49 80 9 6 16 42 6 0 1 8 1 90
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
819 1082 1091 804
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
473 1106 696 1521
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
239 1489 1416 652

Failed to understand id: ?term=("Syrmaticus reevesii"[Organism]) AND (refseq[filter] AND mitochondrion[filter])


Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.